(data stored in ACNUC7421 zone)

EMBL: CP001658.PE507

CP001658.PE507       Location/Qualifiers
FT   CDS_pept        complement(583554..583883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00497"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00497"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23528"
FT                   /protein_id="ACT23528.1"
FT                   /translation="MSFLLDPPLLFVCGVLIERRLPVDRRDAAEAAALGVFFGASFGLY
FT                   HNVPGLGMLWRPFRAQNGRDFMWNSGVFSVDVARAEWPLHAMAAAIFATYPFFIKLGRR
FT                   LGRRI"
     atgagtttcc tgctcgaccc gccgctgctg tttgtctgcg gagtgctcat cgagcgacgc        60
     ctgcccgtgg accgccgcga tgccgccgag gccgccgccc tgggcgtctt cttcggcgct       120
     tcgttcgggc tgtaccacaa cgtacccggg ctcgggatgc tgtggcggcc atttcgcgca       180
     cagaacggcc gcgatttcat gtggaacagc ggggttttca gcgtggatgt ggcccgcgcg       240
     gagtggccgc tgcacgcgat ggccgctgcc atcttcgcaa cgtatccgtt cttcataaag       300
     ctcggccgcc ggctcgggcg ccggatatga                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page