(data stored in ACNUC7421 zone)

EMBL: CP001658.PE508

CP001658.PE508       Location/Qualifiers
FT   CDS_pept        complement(583880..584869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00498"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00498"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23529"
FT                   /protein_id="ACT23529.1"
FT                   /translation="MGESTTQPAGGAAVDDETRSAALPRWRGAAGRLEVWYATLSDPLT
FT                   RTGLWVHCETVAPTTGGPYAHGWVTWFPPDAPPGTERFGSQPAQPAAGPAWFDIAGVRM
FT                   APAELTGRTRSLAWELSWKDTAAPLWTFPRVAWERELLPGAQVVIAPTAVFAGSLAVGE
FT                   TTHRVDSWRGSVAHIYGHGNAKRWGWIHADLGDGDVLEVVTAVSHKPGLRRLAPLAFVR
FT                   FRIDGKDWPASPLPSLRMRTTLGVRHWQLEGRIGGREALIRVDQPPERCVSLGYTDPDG
FT                   AKAVCTNTEQADIHIELGGRHWSVLGTGHAEVGLRGTAAPAIKEGTPA"
     gtgggcgaat cgacaactca gccagcagga ggtgccgcag tggacgatga aacgcggtcg        60
     gcggccttgc cgcggtggcg cggtgcagcc gggcgcctgg aagtctggta tgcgactctg       120
     tcggatccac tgacgcgtac cggcctatgg gtgcactgtg agacggtggc cccgacgacc       180
     ggcgggccct acgcgcacgg ctgggtgacc tggtttccac cggatgcccc gccgggcacc       240
     gagcgcttcg gctcccagcc cgcccaaccc gcggccggcc ccgcctggtt cgacatcgcc       300
     ggtgtacgaa tggcgccagc ggagctgacc ggacgtaccc gatcactcgc atgggagctg       360
     tcctggaagg acaccgcggc gccactgtgg acgtttcctc gcgtggcctg ggagcgcgag       420
     ttgctgcccg gcgcccaagt ggtgatcgca cccaccgccg tcttcgctgg ctccttggcc       480
     gtcggcgaaa ccacccaccg cgtcgacagc tggcgcggca gtgtggccca catctacgga       540
     catggcaatg ccaagcggtg gggatggatc catgccgatc tcggcgacgg cgacgtccta       600
     gaggtggtga ccgcggtatc acacaagccg ggcctacgca ggctcgcgcc gctagcgttc       660
     gttcgcttcc gcatcgacgg aaaggattgg cccgcaagtc ctttaccgtc gctgcgaatg       720
     cggacaacgc tcggcgtgcg gcactggcaa ctggaaggac gcatcggcgg ccgggaggcg       780
     ctaatccggg tagaccagcc gccggagcgg tgcgtaagcc tgggatacac cgatcccgac       840
     ggggccaagg cggtgtgcac caacaccgag caggccgaca tccacatcga gctcggcggc       900
     cggcactggt cggtgctggg caccggacac gccgaagtcg gcctgcgggg aaccgcggca       960
     ccggctatca aggaagggac gccagcatga                                        990
//

If you have problems or comments...

PBIL Back to PBIL home page