(data stored in ACNUC7421 zone)

EMBL: CP001658.PE51

CP001658.PE51        Location/Qualifiers
FT   CDS_pept        55799..57481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00050"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00050"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23072"
FT                   /protein_id="ACT23072.1"
FT                   /translation="MTGALSQSSNISPLPLAADLRSADNRDCPSRTDVLGAALANVVGG
FT                   PVGRHALIGRTRLMTPLRVMFAIALVFLALGWSTKAACLQSTGTGPGDQRVANWDNQRA
FT                   YYQLCYSDTVPLYGAELLSQGKFPYKSSWIETDSNGTPQLRYDGQIAVRYMEYPVLTGI
FT                   YQYLSMAIAKTYTALSKVAPLPVVAEVVMFFNVAAFGLALAWLTTVWATSGLAGRRIWD
FT                   AALVAASPLVIFQIFTNFDALATGLATSGLLAWARRRPVLAGVLIGLGSAAKLYPLLFL
FT                   YPLLLLGIRAGRLNALARTMAAAAATWLLVNLPVMLLFPRGWSEFFRLNTRRGDDMDSL
FT                   YNVVKSFTGWRGFDPTLGFWEPPLVLNTVVTLLFVLCCAAIAYIALTAPHRPRVAQLTF
FT                   LTVASFLLVNKVWSPQFSLWLVPLAVLALPHRRILLAWMTIDALVWVPRMYYLYGNPSR
FT                   SLPEQWFTTTVLLRDIAVMVLCGLVVWQIYRPGRDLVRTGGPGALPACGGVDDPVGGVF
FT                   ANAADAPPGRLPSWLRPRLGDEHARERTPDAGRDRTFSGQHRA"
     gtgaccggcg cgctgtccca aagcagcaac atctcgccac ttcctttggc cgccgatctg        60
     cggagcgccg ataaccgcga ttgccccagc cgcaccgacg tattgggtgc cgctctggcg       120
     aatgtcgtcg gtggcccggt aggccggcac gcgctgatcg gccgcacccg gctgatgacc       180
     ccgctgcggg tgatgtttgc aatcgcgttg gtgttcctgg cgctcggttg gtcgacgaaa       240
     gcggcctgct tgcagtccac cggaaccggt ccaggtgatc agcgggtggc caactgggat       300
     aaccagcgtg cttactacca gttgtgctac tccgatacgg tgccgctcta tggcgctgag       360
     ttattgagcc aaggcaagtt tccgtacaaa tcaagctgga tcgaaaccga cagcaacggc       420
     acaccgcagc tgcgctacga cggacagatc gcggtgcgct atatggagta tccggtgctg       480
     actgggatct atcagtacct gtcgatggcg atagccaaga cctacaccgc gttaagcaag       540
     gtggctcccc tcccggtggt tgccgaagtg gtgatgttct tcaacgtcgc cgcgttcggt       600
     ttggcgctgg cgtggctgac aaccgtctgg gcgacctcgg gcctggccgg ccgccggata       660
     tgggatgcgg cgctggtggc cgcctcaccg ctggtgatct ttcagatatt caccaatttc       720
     gatgcgctgg caacgggttt ggcgacgagt gggctgctgg cctgggcgcg gcgcagaccg       780
     gtgcttgccg gtgtgctgat cgggttgggc tccgcggcga aactgtatcc gctgttgttc       840
     ttgtacccgt tgttgctgct gggcatccgg gccggtcgcc tgaatgctct ggcccgcacc       900
     atggcggccg cggcggcgac ctggttgttg gtgaatctgc cggtgatgct gctctttccg       960
     cgcggctggt cggagttctt ccggctcaac acccggcgcg gcgacgacat ggactcgttg      1020
     tacaacgtcg tcaagtcgtt caccggctgg cgtggcttcg accccaccct gggcttctgg      1080
     gagccgccgc tggtgctgaa cacggttgtc acgctcttgt tcgtgttatg ttgtgcggca      1140
     attgcttaca tcgcgctcac cgcaccccac cggccgcgcg tggcgcagct gactttcttg      1200
     acggtggcca gcttcctgtt ggtcaacaag gtgtggagtc cccagttctc gctttggctg      1260
     gtgccgctgg ccgtgctggc tttgccgcac cgccggatct tgctggcgtg gatgacgatc      1320
     gacgcgttgg tgtgggtgcc gcggatgtac tacctatacg gcaacccgag ccgctcgctg      1380
     cccgagcagt ggttcaccac gacggtgttg ctgcgtgaca tcgccgtgat ggtgctgtgc      1440
     ggactggtgg tctggcagat ctaccgcccc gggcgcgacc tcgtgcgtac cggcgggcca      1500
     ggggcactgc cggcttgtgg gggagtcgac gacccggtgg gaggggtctt tgccaacgcc      1560
     gccgacgccc cgccaggtcg gctaccgtcg tggctgcgtc cccggctggg cgacgagcat      1620
     gcgcgagaga ggacgcccga tgcaggtcgc gatcgcactt tttccgggca acaccgcgct      1680
     tga                                                                    1683
//

If you have problems or comments...

PBIL Back to PBIL home page