(data stored in ACNUC7421 zone)

EMBL: CP001658.PE516

CP001658.PE516       Location/Qualifiers
FT   CDS_pept        591290..591526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00506"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00506"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23537"
FT                   /protein_id="ACT23537.1"
FT                   /translation="MTSTNGPSARDTGFVEGQQAKTQLLTVAEVAALMRVSKMTVYRLV
FT                   HNGELPAVRVGRSFRVHAKAVHDMLETSYFDAG"
     atgacgtcta cgaacgggcc atcggcgcgg gataccggtt ttgttgaggg ccagcaggcc        60
     aagacacaac ttctcaccgt ggccgaagtg gcggccctga tgcgggtgtc caagatgacg       120
     gtgtaccggc tggtgcacaa tggcgaactg cccgcggttc gggtcgggcg gtcattccgg       180
     gtgcatgcca aggccgtcca cgacatgttg gagacttcgt acttcgacgc gggctag          237
//

If you have problems or comments...

PBIL Back to PBIL home page