(data stored in ACNUC7421 zone)

EMBL: CP001658.PE517

CP001658.PE517       Location/Qualifiers
FT   CDS_pept        591570..591755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00507"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00507"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23538"
FT                   /protein_id="ACT23538.1"
FT                   /translation="MLGRCRFGVPCDRPGRVSGSDSRIDGGVMGSVIKKRRKRMSKKKH
FT                   RKLLRRTRVQRRKLGK"
     atgctcgggc gctgccggtt tggtgttccg tgcgaccgcc cgggtagagt gtccgggtca        60
     gatagccgta tagatggcgg ggtcatgggt tcagtaatca agaagcggcg caagcgcatg       120
     tccaagaaaa agcatcgcaa gctgctgcgt cgcacccggg tgcagcgcag gaaactgggc       180
     aaatag                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page