(data stored in ACNUC7421 zone)

EMBL: CP001658.PE519

CP001658.PE519       Location/Qualifiers
FT   CDS_pept        592970..594046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00509"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00509"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23540"
FT                   /protein_id="ACT23540.1"
FT                   /translation="MGNVAGETRANVIPLHTNRSRVAARRRAGQRAESRQHPSLLSDPN
FT                   DRASAEQIAAVVREIDEHRRAAGATTSSTEATPNDLAQLVAAVAGFLRQRLTGDYSVDE
FT                   FGFDPHFNSAIVRPLLRFFFKSWFRVEVSGVENIPRDGAALVVANHAGVLPFDGLMLSV
FT                   AVHDEHPAHRDLRLLAADMVFDLPVIGEAARKAGHTMACTTDAHRLLASGELTAVFPEG
FT                   YKGLGKRFEDRYRLQRFGRGGFVSAALRTKAPIVPCSIIGSEEIYPMLTDVKLLARLFG
FT                   LPYFPITPLFPLAGPVGLVPLPSKWRIAFGEPICTADYASTDADDPMVTFELTDQVRET
FT                   IQQTLYRLLAGRRNIFFG"
     atgggtaacg tggcgggcga aaccagagcg aatgtcattc cactgcacac aaatcggagc        60
     cgggtagcgg cgcgcaggcg tgccggtcaa cgggcagagt cccggcagca tccgtcgttg       120
     ctgtccgatc caaatgaccg ggcgtcggcc gagcagatcg ccgccgttgt ccgggaaatc       180
     gacgaacacc ggcgcgctgc gggtgccacg acctcgtcca ccgaggccac gcccaacgac       240
     cttgcgcaac tcgtcgccgc ggttgctgga tttctccgac agcgcctgac cggtgactac       300
     agcgtcgacg aattcgggtt cgacccgcac ttcaacagcg ccatcgtacg acccttgctg       360
     cgattcttct tcaagtcatg gtttcgggtc gaagtcagtg gtgtcgagaa catcccgcgc       420
     gatggtgcgg cgctggtggt ggccaatcac gcaggtgtgt tgccgtttga cgggttgatg       480
     ttgtcggtgg ccgtccacga cgagcacccg gcgcatcggg atctgcggct gcttgccgcc       540
     gacatggtgt tcgacctccc cgtgatcggc gaagccgccc gcaaggcggg tcataccatg       600
     gcgtgtacga cggatgcgca ccggttgctt gcctccggcg aactcaccgc ggtgttcccc       660
     gagggataca aggggctggg taagcgtttc gaggaccgtt accggttaca gcggtttggt       720
     cgcggcggct tcgtatcggc cgcgctacgg accaaggcgc cgattgtgcc gtgttcgatc       780
     atcggctccg aagagatcta ccccatgctg accgatgtca agctgctggc tcggctgttc       840
     ggcctgccgt acttcccgat tacgccgttg ttcccgttgg ctggaccggt cgggctagtg       900
     ccgttgccct cgaaatggcg catcgcgttc ggtgagccga tctgcaccgc cgactacgcc       960
     tccaccgacg ccgacgaccc gatggtgacg ttcgagttga ccgatcaggt gcgcgagacg      1020
     atccagcaga cgctataccg actgcttgcc ggccgtcgca acatcttttt cggctga         1077
//

If you have problems or comments...

PBIL Back to PBIL home page