(data stored in ACNUC7421 zone)

EMBL: CP001658.PE521

CP001658.PE521       Location/Qualifiers
FT   CDS_pept        complement(594981..595481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00511"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00511"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23542"
FT                   /protein_id="ACT23542.1"
FT                   /translation="MTVPEEAQTLIGKHYRAPDHFLVGREKIREFAVAVKDDHPTHYSE
FT                   PDAAAAGYPALVAPLTFLAIAGRRVQLEIFTKFNIPINIARVFHRDQKFRFHRPILAND
FT                   KLYFDTYLDSVIESHGTVLAEIRSEVTDAEGKPVVTSVVTMLGEAAHHEADADATVAAI
FT                   ASI"
     atgacagttc ccgaagaagc ccagacactg atcggcaagc attatcgggc gccggaccac        60
     tttctggtgg ggcgcgagaa gatccgcgag ttcgcggtcg cggtcaaaga cgaccacccg       120
     acccactaca gcgagccgga tgccgcagcg gccggttacc ccgcgctggt agccccgctg       180
     accttcctgg cgatcgccgg ccggcgcgtg cagctggaga tcttcaccaa gttcaatatc       240
     ccgatcaaca tcgcccgggt ctttcatcgc gaccagaagt tccgcttcca ccggccgatc       300
     ctggccaacg acaagctgta cttcgacacc tatcttgact ccgtcatcga atcccacggc       360
     acggtgctcg ccgagatccg aagcgaagtt accgacgccg aaggaaagcc tgtggtcacc       420
     agtgtcgtca ccatgttggg agaagcggcc caccacgaag ccgatgccga tgcaacggtg       480
     gcggcgattg catcgatcta g                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page