(data stored in ACNUC7421 zone)

EMBL: CP001658.PE523

CP001658.PE523       Location/Qualifiers
FT   CDS_pept        596938..597381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00513"
FT                   /product="membrane protein mmpS2"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00513"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23544"
FT                   /protein_id="ACT23544.1"
FT                   /translation="MRMISVSGAVKRMWLLLAIVVVAVVGGLGIYRLHSIFGVHEQPTV
FT                   MVKPDFDVPLFNPKRVTYEVFGPAKTAKIAYLDPDARVHRLDSVSLPWSVTVETTLPAV
FT                   SVNLMAQSNADVISCRIIVNGAVKDERSETSPRALTSCQVSSG"
     gtgaggatga tttcggttag cggcgccgtg aaacgcatgt ggttgctgct ggccatcgtc        60
     gtggtggccg ttgtcggggg gcttggtatc tatcggctgc acagcatctt cggtgttcac       120
     gagcaaccca ctgtcatggt caagcctgat ttcgacgtcc cgctgttcaa ccccaagcgg       180
     gtgacctacg aagtctttgg ccccgccaag accgcaaaga tcgcctacct ggaccctgat       240
     gcccgggtgc atcgactcga tagcgtgtcc ctgccgtggt ccgtcacggt cgagacgacg       300
     ctgcccgcgg tcagcgtcaa cctcatggcg cagagtaacg ccgacgtgat cagctgccgg       360
     atcatcgtca acggcgccgt taaggacgaa aggtctgaga cctcgccgcg agcgctaacc       420
     tcctgccagg tgtcatccgg atga                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page