(data stored in ACNUC7421 zone)

EMBL: CP001658.PE525

CP001658.PE525       Location/Qualifiers
FT   CDS_pept        600277..600570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00515"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00515"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23546"
FT                   /protein_id="ACT23546.1"
FT                   /translation="MSRPQVELLTRAGCAICVRVAEQLAELSSELGFDMMTIDVDVAAS
FT                   TGNPGLRAEFGDRLPVVLLDGREHSYWEVDEHRLRADIARSTFGSPPDKRLP"
     atgagtaggc cccaggtgga gcttttgact cgcgccgggt gcgcgatctg cgtgcgggta        60
     gcggagcagc tggccgaact gtccagcgaa ctgggcttcg acatgatgac gatcgacgtc       120
     gatgtcgcgg cgtcgacggg caatccaggg ctgcgagctg agtttggcga tcggttgccg       180
     gtggtcctgc tggacggccg cgagcacagc tactgggagg tcgacgagca ccggctgcgt       240
     gcggatatag cccgcagcac atttggtagc ccacctgata aacgtctacc gtag             294
//

If you have problems or comments...

PBIL Back to PBIL home page