(data stored in ACNUC7421 zone)

EMBL: CP001658.PE532

CP001658.PE532       Location/Qualifiers
FT   CDS_pept        606706..608241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00522"
FT                   /product="13E12 repeat family protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00522"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23553"
FT                   /protein_id="ACT23553.1"
FT                   /translation="MFDQVRGRMPSPEAIAHFDERFECHAPRTTRVSAAFIDRICSATR
FT                   AENRAAAAQLVALGELFAYRWSRCGGREEWVMDTMAAVAAEVAAALRISQGLAASRLRY
FT                   ARAMRERLPKTAEVFSAGDIGYLMFATIVYRTDLIVDPDVLAAVDAQLAANVARWPSMT
FT                   KARLAGQVDKIVARADADAVRRRKEYQAQRQFWVGESQDGVCQIGGSLLAVDAHALDAR
FT                   LSALAGTVCEHDPRSREQRRADALGALAGGADRLGCGCGRADCAAGKRPAAPPVVIHLI
FT                   AEAATINGTGSAPASQMNADGLITAELVAELAKTATLVPLVHPGDAPPEPGYAPSKALA
FT                   DFVRCRDLTCRWPGCDEPATNCDLDHTIPYAAGGPTHASNLKCYCRTHHLVKTFWGWRD
FT                   QQLPDGTLILTSPSGHTYVSTPGSALLFPSLCHFSGGIPAPEADPPYDHCDQRTAMMPK
FT                   RRRTRAQDRAYRIATERRQNHAARQRAQVLTQTAAATDTHGPPPDHNDDPPPF"
     atgttcgatc aggtgcgggg gcgcatgcct tcaccggagg cgatcgctca ttttgatgag        60
     cggtttgaat gccatgctcc gcggaccacg agggtgtcgg cggcgttcat cgatcggatc       120
     tgctcggcga ctcgggccga aaaccgggcc gctgcggcgc agttggtggc gttgggggag       180
     ttgttcgcct atcggtggtc gcgttgcggg ggccgcgagg agtgggtgat ggacaccatg       240
     gcggcggtgg ccgccgaggt ggcggcggcg ttgcggatca gtcagggtct ggcggccagc       300
     cggttgcggt atgcgcgggc gatgcgtgag cggctgccta agacggctga ggtgtttagc       360
     gccggcgaca tcggctatct gatgtttgcc acgattgtgt atcgcaccga cttgatcgtt       420
     gaccctgatg ttttggcggc ggtggatgcg cagttggccg ccaatgtggc gcgttggccc       480
     tcgatgacca aggcccgcct ggctgggcag gtcgataaga tcgtggcgcg tgccgatgcc       540
     gatgcggtgc ggcggcgcaa ggagtatcag gcccagcgcc agttctgggt cggggaaagc       600
     caagacggtg tgtgccagat cggtggcagc ctgttggccg tcgacgcaca cgccctcgat       660
     gcgcggttga gcgcgttggc gggcaccgtg tgtgagcacg atccgcgcag ccgtgagcag       720
     cgccgcgcgg acgcgttggg ggcgttggcg ggcggggccg atcggctggg ctgtggctgt       780
     gggcgcgctg attgtgcggc cgggaagcgg cctgcggccc cgccggtggt gattcacctg       840
     atcgccgagg cggccacgat caatggcacg ggctcggcgc cggcatcgca gatgaacgcc       900
     gacgggctga tcaccgccga actggtggcc gagctggcca agacggccac gctggtgccg       960
     ctggttcatc ccggcgatgc gccgcccgag ccggggtatg cgccgtcgaa agcgctcgcc      1020
     gatttcgttc gctgccggga tctgacgtgt cgctggcccg gctgtgatga gcccgccacc      1080
     aattgcgacc tggatcatac gatcccgtat gccgctggtg ggcccaccca tgcgtcgaac      1140
     ctgaaatgtt actgccgtac ccatcacctg gtgaaaacgt tttggggatg gcgtgatcaa      1200
     cagctacccg acggcaccct gattttgacc tccccgtccg ggcataccta tgtcagcacc      1260
     ccgggcagtg cgctgctgtt ccccagcttg tgccacttca gcggcggcat cccggcaccg      1320
     gaagccgacc caccctacga ccattgcgac cagcgcacag cgatgatgcc caaacgccgg      1380
     cgcacccgcg cccaagaccg ggcctatcgc atcgccaccg aacgtcgaca aaaccacgcc      1440
     gcccgccagc gcgcccaggt gctcacccag accgccgcgg ccaccgacac ccacggccca      1500
     ccaccggatc acaacgacga cccaccgccg ttttag                                1536
//

If you have problems or comments...

PBIL Back to PBIL home page