(data stored in ACNUC7421 zone)

EMBL: CP001658.PE535

CP001658.PE535       Location/Qualifiers
FT   CDS_pept        610367..611062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00525"
FT                   /product="hypothetical exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00525"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23556"
FT                   /protein_id="ACT23556.1"
FT                   /translation="MSRPGTYVIGLTLLVGLVVGNPGCPRSYRPLTLDYRLNPVAVIGD
FT                   SYTTGTDEGGLGSKSWTARTWQMLAARGVRIAADVAAEGRAGYGVPGDHGNVFEDLTAR
FT                   AVQPDDALVVFFGSRNDQGMDPEDPEMLAEKVRDTFDLARHRAPSASLLVIAPPWPTAD
FT                   VPGPMLRIRDVLGAQARAAGAVFVDPIADHWFVDRPELIGADGVHPNDAGHEYLADKIA
FT                   PLISMELVG"
     gtgagtcgcc cgggtacata cgtcattggt ctcactctcc tggtcggcct ggtcgtcggc        60
     aatccagggt gcccgcggtc ctaccgccca ctgaccctgg attaccggct taacccggtc       120
     gcggtgattg gcgactccta taccaccggc accgatgagg gcggtctggg ctcgaaatca       180
     tggaccgctc gcacctggca gatgctcgct gcacgtggcg tgcggatcgc agccgacgtg       240
     gccgccgagg gccgggccgg ctacggggtg cccggcgacc acggcaacgt gtttgaggat       300
     ctgaccgcca gggccgtcca gcccgacgat gcactggtgg tgttctttgg ctcccgcaac       360
     gaccaaggca tggatcctga ggatcccgag atgctggccg aaaaggtccg cgacactttc       420
     gatctagcgc gccaccgcgc accatccgcg agcttgctgg tgatcgcacc gccgtggcct       480
     accgccgacg tacctggccc aatgctgcgg attcgcgacg tgctgggcgc tcaggcgcgg       540
     gccgcaggag cagtgtttgt cgacccgatc gccgaccact ggtttgtcga caggcccgag       600
     ctgatcggcg cggatggcgt gcatcccaac gatgcgggac atgagtatct ggcggacaag       660
     atcgcgccgc tgatcagcat ggagttggtt ggatga                                 696
//

If you have problems or comments...

PBIL Back to PBIL home page