(data stored in ACNUC7421 zone)

EMBL: CP001658.PE54

CP001658.PE54        Location/Qualifiers
FT   CDS_pept        58689..59183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00053"
FT                   /product="single-strand binding protein ssb"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00053"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23075"
FT                   /protein_id="ACT23075.1"
FT                   /translation="MAGDTTITIVGNLTADPELRFTPSGAAVANFTVASTPRIYDRQTG
FT                   EWKDGEALFLRCNIWREAAENVAESLTRGARVIVSGRLKQRSFETREGEKRTVIEVEVD
FT                   EIGPSLRYATAKVNKASRSGGFGSGSRPAPAQTSSASGDDPWGSAPASGSFGGGDDEPP
FT                   F"
     gtggctggtg acaccaccat caccatcgtc ggaaatctga ccgctgaccc cgagctgcgg        60
     ttcaccccgt ccggtgcggc cgtggcgaat ttcaccgtgg cgtcaacgcc ccggatctat       120
     gaccgtcaga ccggcgaatg gaaagacggc gaagcgctgt tcctccggtg caatatctgg       180
     cgggaggcgg ccgagaacgt ggccgagagc ctcacccggg gggcacgagt catcgttagc       240
     gggcggctta agcagcggtc gtttgaaacc cgtgagggcg agaagcgcac cgtcatcgag       300
     gtcgaggtcg atgagattgg gccttcgctt cggtacgcca ccgccaaggt caacaaggcc       360
     agccgcagcg gcgggtttgg cagcggatcc cgtccggcgc cggcgcagac cagcagcgcc       420
     tcgggagatg acccgtgggg cagcgcaccg gcgtcgggtt cgttcggcgg cggcgatgac       480
     gaaccgccat tctga                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page