(data stored in ACNUC7421 zone)

EMBL: CP001658.PE544

CP001658.PE544       Location/Qualifiers
FT   CDS_pept        617672..618451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00534"
FT                   /product="cytochrome C biogenesis protein ccdA"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00534"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23565"
FT                   /protein_id="ACT23565.1"
FT                   /translation="MTGFTEIAAVGPLLVAVGVCLLAGLVSFASPCVVPLVPGYLSYLA
FT                   AVVGVDEQLPAGVVKPPVAARWRVAGSAALFVAGFTTVFVLGTVAVLGMTTTLITNQLL
FT                   LQRVGGVLIVVMGLVFVGFIGALQRQARFTPRQLTSVAGAPVLGAVFALGWTPCLGPTL
FT                   TGVITVASATEGASVARGIVLVIAYCLGLGIPFVLLAFGSAWAVAGLGWLRRHTRAIQI
FT                   FGGALLIAVGAALVTGVWNDVVSWLRDAFVSDVRLPI"
     atgaccgggt tcaccgagat tgccgcggtg gggccactgc tggtggcggt gggggtatgt        60
     ctgctggctg gtctggtgtc gttcgcctca ccatgtgtgg tgccgctggt gcccggctac       120
     ctgtcgtatc tggcggccgt cgttggggtg gacgagcagc tgccggccgg cgtcgtcaaa       180
     cccccggtgg ctgcccgctg gcgggtcgcc ggatcggcgg cgctgttcgt ggcggggttc       240
     acgacggtgt tcgtgctggg caccgtcgcc gtcttgggca tgaccaccac gctgatcacg       300
     aatcagctgc tgctgcagcg ggtcggaggc gtgctgatcg tcgtcatggg cctggtgttc       360
     gtggggttca tcggagccct gcagcgccag gcgaggttca cgccgcgcca gttgacgagc       420
     gtagcggggg cgccggtgct tggcgcggtg ttcgcgctcg gctggacacc gtgcctgggg       480
     ccgacgctga ccggggtgat caccgttgcc tcggccaccg agggtgccag cgtggcgcgt       540
     gggatcgtgc tggtgattgc ctattgcctg gggctgggga ttccgttcgt gcttttggcg       600
     ttcggttcgg cgtgggcggt ggcgggcctg ggctggctgc gccggcacac cagggccatc       660
     cagatcttcg gcggggcgct gctgatcgcg gtcggtgccg cgctggtcac cggggtgtgg       720
     aacgacgtcg tgtcgtggct gcgcgacgcc ttcgtttccg acgtgaggtt gccgatttga       780
//

If you have problems or comments...

PBIL Back to PBIL home page