(data stored in ACNUC7421 zone)

EMBL: CP001658.PE547

CP001658.PE547       Location/Qualifiers
FT   CDS_pept        621086..622303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00537"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00537"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23568"
FT                   /protein_id="ACT23568.1"
FT                   /translation="MLVTEHPRTGVGAPDSGNGGTDHPTVQLPPVPSVGAPPAAAGGET
FT                   PTRSVAGFRTQRLDPTAYGAYYSGPDEGPASPAERPPYRLEPVPHTPYPELATTTLLRP
FT                   VKPPPSEGWRRLLYLLSGRLINAGEGPRAAHLNDLVAQVNRPLRGCYRIAVLSLKGGVG
FT                   KTTITATLGATFADLRGDRVVAVDANPDRGTLSQKVPLETPATVRHLLRDADGIERYSD
FT                   VRGYTSKGPSGLEVLASDSDPASSDAFSADDYTRTLDILERFYGLVLTDCGTGLLHSAM
FT                   SAVLPRSDVLVVVSSGSIDGARSAAATLDWLQAHGHDDQVRNSIAVVNAVRPRAGKVDV
FT                   GKVVEHFSRRCRAVRVVPFDPHLEEGAEIALDRLRRETREALTELAAVVAAGFPGDPRR
FT                   CKPSFT"
     gtgctggtga ccgagcatcc gaggacgggc gtgggagccc ccgatagcgg caacggcggc        60
     acggatcatc cgaccgtgca gttgccgccc gtgccatccg tgggggcacc accggctgcg       120
     gccggtggtg aaacaccgac taggtcagtt gcgggattcc gcacccagcg gctcgacccg       180
     acggcctacg gcgcctacta cagcggcccc gatgagggcc cggccagccc ggctgaaagg       240
     ccgccgtatc gtctcgagcc ggtgccccat acgccgtatc cggaactggc caccaccacg       300
     ctgctgaggc cggtcaagcc gccaccgtcg gaaggctggc gtcggttgct ctatctgctg       360
     tcgggtcggc tgatcaacgc cggggaaggc cctcgggccg cgcacctcaa cgacctggtc       420
     gctcaggtca accgcccgct gcgcggctgc taccggatcg cggtgttgtc gttgaaaggg       480
     ggtgtcggca agaccacgat caccgcgacc ctgggggcca cctttgccga cctgcgcggt       540
     gaccgggttg tcgcggtcga cgccaatccc gaccgcggca cactgagcca aaaggtcccg       600
     ctcgagacgc cggccacggt gcggcacctg ctgcgcgacg ccgacggcat cgagcgctac       660
     agcgacgttc gcggctacac atcgaaggga cccagcgggc tggaagtgct ggcatcggac       720
     agtgatccgg cctcctcgga cgcattcagc gccgacgact acacccgcac cctggacatt       780
     ctggagcggt tctacggcct ggtgctcacc gactgcggta ccgggttgct gcactcggcg       840
     atgtcggcgg ttctgcctag gtccgacgta ctggtcgtgg tcagctcggg gtccatcgac       900
     ggcgcccgca gcgccgcggc gacgctggac tggctgcagg cccacggcca cgacgaccag       960
     gtgcgcaact cgatcgccgt cgtcaacgcg gtgcggccgc gcgcgggcaa ggtcgacgtg      1020
     ggcaaggtcg tcgagcactt ctccaggcgt tgccgtgcgg tgcgcgtggt gccgttcgac      1080
     ccacacctcg aagaaggcgc cgaaatcgcg ctggatcggt tgcggcggga gacccgcgaa      1140
     gcgctcaccg aactggcagc ggtggtggcc gctggattcc ccggcgaccc gcggcgctgc      1200
     aaaccgagct tcacctag                                                    1218
//

If you have problems or comments...

PBIL Back to PBIL home page