(data stored in ACNUC7421 zone)

EMBL: CP001658.PE55

CP001658.PE55        Location/Qualifiers
FT   CDS_pept        59225..59479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00054"
FT                   /product="30S ribosomal protein S18 rpsR1"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00054"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23076"
FT                   /protein_id="ACT23076.1"
FT                   /translation="MAKSSKRRPAPEKPVKTRKCVFCAKKDQAIDYKDTALLRTYISER
FT                   GKIRARRVTGNCVQHQRDIALAVKNAREVALLPFTSSVR"
     atggccaagt ccagcaagcg gcgcccggct ccggaaaagc cggtcaagac gcgtaaatgc        60
     gtgttctgcg cgaagaagga ccaagcgatc gactacaagg acaccgcgct gttgcgcacc       120
     tacatcagcg agcgcggcaa gatccgcgcg cgtcgggtca cgggcaactg cgtgcagcac       180
     cagcgagaca tcgcgctcgc ggtgaagaac gcccgcgagg tggcgctgct gccctttacg       240
     tcttcggtgc ggtag                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page