(data stored in ACNUC7421 zone)

EMBL: CP001658.PE554

CP001658.PE554       Location/Qualifiers
FT   CDS_pept        complement(628559..629992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00543"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00543"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23575"
FT                   /protein_id="ACT23575.1"
FT                   /translation="MGLSSDDTRRREVVRDLAAGALLIGALFFPWNLYFGFRIPDSSKT
FT                   VFGLLLAVTSLSLASLAVTFAGRRSQLRLGLNVPYLLLVLAFVVFDAIQTIRLGGTVHV
FT                   PGGVGPGGWLGITGALLSAQPALTGATTDEGSHSRWLRATQFLGYASMLGAALSTGFNL
FT                   SWRVRYALEPAAGASGFGKQNLAVIDTAVVYGVVALAAVLVASRWLLRPTAAEALSTVA
FT                   LGGSTLIAGSIVWSLPIGREIDAFHGIAQNTSTAGVGYEGYLVWAAAAAMCAPLTLFRS
FT                   PNAPPIDKTVWRAASRNGLLLIAVWCLGSVAMRLTDLVVAVLLNYPFSRYDSMALAAFD
FT                   LATAVLAIWLRFNMATEALPARLISSLCGLLCTFTVSRVIVGVVLAPRFQASSGGSAHP
FT                   VYGNDLAQQITSTFDVVLCGLALSILAAAIVIGRLRQLPQPPHTPALSRPAGSPRIFRS
FT                   AGSTHPVRPKIYRPPDHSS"
     gtgggcctga gcagcgacga cacccgacga cgcgaggtcg tccgcgactt ggccgctggt        60
     gccctgctca tcggtgcgct gtttttccca tggaacctgt atttcggttt ccgaatcccg       120
     gacagcagca agaccgtgtt cgggttgctg ctggcggtga catcgctctc tttggcatcg       180
     cttgccgtga ccttcgccgg gaggcgctca cagcttcgcc tgggcctcaa cgtcccctat       240
     ctgctgctgg tgctggcctt cgtggtgttc gacgcgatcc agacgattcg actcggcggc       300
     accgtccacg tgcccggtgg tgtcgggccg gggggatggc tggggatcac cggcgcgctg       360
     ttgagcgcgc aaccggcgct aaccggcgct accaccgatg agggcagcca cagcaggtgg       420
     ctgcgggcca cccagttcct cggctacgcg tctatgttgg gtgcggccct cagcaccggt       480
     ttcaacctga gctggcgggt caggtacgcg ttggagcccg cggccggcgc gtccggtttt       540
     ggcaaacaga acctcgcggt catcgacacg gcggtggtgt acggcgtggt agccctggcc       600
     gccgtgctgg tcgcgtcccg gtggctgctt cggcctacag cggccgaagc gctctcaacc       660
     gtggcgctgg gtggctccac cctgatcgcc gggtccatcg tgtggagcct tcccatcggc       720
     cgcgagatcg acgcgttcca cggcattgcc caaaacacgt cgacggccgg cgtgggatac       780
     gagggttatc tggtgtgggc cgcggccgcg gcaatgtgtg cgccgctgac cctgttcagg       840
     tccccgaacg cgccaccgat cgacaaaacc gtgtggcggg cagcgtcccg aaacggcttg       900
     ctgctcatcg ccgtgtggtg cctgggctcg gtagcgatgc ggttgaccga cctcgtcgtc       960
     gcggtgctgt tgaattatcc gttctcgcgc tacgacagca tggcgctggc tgcgttcgat      1020
     ctggccaccg cggtcctagc gatctggctt cgcttcaaca tggcgaccga ggccctgccc      1080
     gcgaggctga tctcgtcgct gtgcggattg ctatgcacat tcaccgtttc gcgcgtcatc      1140
     gtcggcgtcg tcctggctcc gcgattccag gcatcttcgg gcgggtcggc tcaccccgtc      1200
     tacggaaacg atcttgccca gcagatcacc agcaccttcg atgtggtgct gtgcggcctg      1260
     gcgctcagca tcctcgcggc ggccatcgtc atcggcaggc tgcgccagct gccgcaaccc      1320
     ccgcacaccc cggcgctgtc ccggcctgct ggatcccccc ggattttcag gtcagctggg      1380
     tcgacgcacc cagtgcggcc gaagatctac cggccgccgg accactcgtc gtag            1434
//

If you have problems or comments...

PBIL Back to PBIL home page