(data stored in ACNUC7421 zone)

EMBL: CP001658.PE555

CP001658.PE555       Location/Qualifiers
FT   CDS_pept        630301..631947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00544"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00544"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23576"
FT                   /protein_id="ACT23576.1"
FT                   /translation="MDVALGVAVTDRVARLALVDSAAPGTVIDQFVLDVAEHPVEVLTE
FT                   TVVGTDRSLAGENHRLVATRLCWPDQAKADELQHALQDSGVHDVAVISEAQAATALVGA
FT                   AHAGSAVLLVGDETATLSVVGDPDAPPTMVAVAPVAGADATSTVDTLMARLGDQALAPG
FT                   DVFLVGRSAEHTTVLADQLRAASTMRVQTPDDPTFALARGAAMAAGAATMAHPALVADA
FT                   TTSLPPAEAGQSGSEGEQLAYSQASDYELLPVDEYEEHDEYGAAADRSAPLSRRSLLIG
FT                   NAVVAFAVIGFASLAVAVAVTIRPTAASKPVEGHQNAQPGKFMPLLPTQQQAPVPPPPP
FT                   DDPTAGFQGGTIPAVQNVVPRPGTSPGVGGTPASPAPEAPAVPGVVPAPVPIPVPIIIP
FT                   PFPGWQPGMPTIPTAPPTTPVTTSATTPPTTPPTTPVTTPPTTPPTTPVTTPPTTPPTT
FT                   PVTTPPTTVAPTTVAPTTVAPTTVAPTTVAPATATPTTVAPQPTQQPTQQPTQQMPTQQ
FT                   QTVAPQTVAPAPQPPSGGRNGSGGGDLFGGF"
     atggacgtcg ctttgggggt tgcggtcacg gatcgggtcg cgcgtctggc gctggtcgac        60
     tcggctgcgc ccggcaccgt gatcgaccag ttcgtgctcg atgtggccga gcacccggtc       120
     gaggtgttaa ccgagaccgt ggtgggcacg gatcggtcat tggccggcga aaaccaccgg       180
     ctggtcgcta cccggctgtg ttggccggat caggccaaag ctgacgagct gcagcacgca       240
     ctgcaggact ccggggtcca cgacgttgcc gtgatatccg aggcgcaggc cgccacggcg       300
     ctggtcgggg cggcacatgc cggctctgcc gtgctgttgg tgggtgatga gacggcaacc       360
     ttatcggtgg ttggtgaccc ggacgcgccg ccgacgatgg tggccgtcgc gccggtggcg       420
     ggcgccgacg ccacatcgac cgtcgatacc ctgatggccc ggctcggcga ccaggccctc       480
     gccccggggg atgtcttcct ggtgggtagg tccgccgagc acaccacggt tcttgccgac       540
     cagctgcgcg cggcgtcgac gatgcgcgtg cagactcccg acgaccccac gttcgcgctg       600
     gcccgtggcg cggcgatggc ggccggcgcc gctacgatgg cgcacccggc cctggtcgcg       660
     gatgcgacca cttcgctccc cccggccgag gcggggcaat cgggttctga aggcgagcag       720
     ctggcgtact cgcaggccag cgattacgag ctgcttccgg tcgacgaata tgaggaacac       780
     gacgaatacg gggcagccgc ggatcgctcg gcgccgttga gccgacggtc gctgctgatc       840
     ggcaacgctg tcgtggcctt tgcggtgatc ggtttcgcct cgctggcggt ggcggtggcg       900
     gtcaccatcc gaccgaccgc ggcctcaaaa ccggtagagg gacaccaaaa cgcccagcca       960
     gggaagttca tgccgttgtt gccgacgcaa cagcaggcgc cggtcccgcc gcctccgccc      1020
     gatgatccca ccgctggatt ccagggcggc accattccgg ctgtacagaa cgtggtgccg      1080
     cggccgggta cctcacccgg ggtgggtggg acgccggctt cgcctgcgcc ggaagcgccg      1140
     gccgtgcccg gtgttgtgcc tgccccggtg ccaatcccgg tcccgatcat cattcccccg      1200
     ttcccgggtt ggcagcctgg aatgccgacc atccccaccg caccgccgac gacgccggtg      1260
     accacgtcgg cgacgacgcc gccgaccacg ccgccgacca cgccggtgac cacgccgcca      1320
     acgacgccgc cgaccacgcc ggtgaccacg ccgccaacga cgccgccgac cacgccggtg      1380
     accacgccac caacgaccgt cgccccgacg accgtcgccc cgacgacggt cgctccgacc      1440
     accgtcgccc cgaccacggt cgctccagcc accgccacgc cgacgaccgt cgctccgcag      1500
     ccgacgcagc agcccacgca acaaccaacc caacagatgc caacccagca gcagaccgtg      1560
     gccccgcaga cggtggcgcc ggctccgcag ccgccgtccg gtggccgcaa cggcagcggc      1620
     gggggcgact tattcggcgg gttctga                                          1647
//

If you have problems or comments...

PBIL Back to PBIL home page