(data stored in ACNUC7421 zone)

EMBL: CP001658.PE558

CP001658.PE558       Location/Qualifiers
FT   CDS_pept        complement(633316..634665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00547"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00547"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23579"
FT                   /protein_id="ACT23579.1"
FT                   /translation="MRIGRREGLAVAIGFVLVGAAFVLPRLNLGIKPRSDIGLERFATR
FT                   AGAAPIFGYWDAHVGWGTAPAVLTAVAVVAWGPVVAHRLPWRVLTLSTWATAAAWAFSL
FT                   AMIDGWQRGFAGRLTTRDEYLWQVPGIADIPATLRTFTSRILDFQPNSWVTHVSGHPPG
FT                   ALLTFVWLDRIGLRGGGWAGLVCLLVGSSAAAAVLIAVRVLASEQMARRTAPFVAVAPT
FT                   AIWIAVSADGYFAGVAAWGIALLAVAVHGATRFPALVAAGAGLLLGWGVFLNYGLVLIV
FT                   LPGMAVLAAADWRPVLRALGPAVLAALVVAVSFAVAGFSWFDGYTLVQQRYWQGIAKDR
FT                   PFGYWSWANLACVVCAIGLGSVAGLSRVFDRAAISRRSGCHLLLLAVLAAIALADLSML
FT                   SKAETERIWLPFTIWLTAAPALLPPRSHRLWLAVNAAGALLLNSIIFTNW"
     gtgaggatcg gtcgccgcga gggattggcc gtcgcgatcg ggtttgtcct ggtcggcgcc        60
     gcgttcgtac tgccgcggtt gaacctggga atcaaaccgc gatccgatat cggcttggag       120
     cggtttgcca cgcgcgccgg cgccgcgccg atcttcggct actgggacgc ccatgttggc       180
     tggggcacgg ccccggcggt tcttaccgca gtggccgttg tggcgtgggg gccggtagtg       240
     gcgcaccggc tcccctggcg ggtgctgacg ctgagcacct gggccaccgc cgccgcctgg       300
     gcgttctcac tggcgatgat cgacggctgg cagcgcggct ttgccggccg attgaccacc       360
     cgtgacgagt acctgtggca ggtgcccggc attgccgaca tcccggcgac gttgcggacg       420
     ttcaccagcc ggattctcga cttccagccc aattcctggg tgactcacgt ctccgggcac       480
     ccgccgggtg cgctgctgac gtttgtctgg ctggatcgga tcgggctgcg cggtggcggt       540
     tgggcggggc tggtgtgcct gctggtggga tccagcgcgg cggcggcggt gctgatcgcc       600
     gtgcgggtgc tggccagtga gcagatggcg cggcggacgg caccattcgt cgcggtggcg       660
     ccgacggcga tctggatcgc ggtttcggcc gacgggtatt tcgccggtgt ggcggcgtgg       720
     ggtatcgccc tgttggcggt ggcggtgcat ggtgccactc gcttcccggc gctggtggcg       780
     gccggagcgg ggctactgct cggctggggt gtctttctca actacgggct cgtgctgatc       840
     gtgctgccgg ggatggcggt gttggccgcc gcagattggc ggcccgtcct gcgggcactg       900
     gggccggccg tgctggcggc gctggtggtc gcggtgagct tcgcggttgc cggattctcc       960
     tggttcgacg gttataccct tgtccagcaa cgctattggc aggggatcgc caaagatcgg      1020
     ccgttcggct attggtcctg ggcaaacttg gcgtgcgtgg tctgcgctat cgggttaggc      1080
     agcgtcgcag gtctcagccg ggtattcgac cgggccgcga tcagtcgtcg atccggctgc      1140
     catctgctgc tgctggcggt gctggccgcc atcgccttgg ccgacctgag catgctgagc      1200
     aaagccgaga ccgaacgaat ctggctgccc ttcaccattt ggctgaccgc ggcgcccgca      1260
     ctgctgccgc cccgctcgca ccgactctgg ctggcggtca acgccgccgg ggccctactg      1320
     ctgaacagca tcatcttcac caactggtaa                                       1350
//

If you have problems or comments...

PBIL Back to PBIL home page