(data stored in ACNUC7421 zone)

EMBL: CP001658.PE561

CP001658.PE561       Location/Qualifiers
FT   CDS_pept        complement(636196..636474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00550"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00550"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23582"
FT                   /protein_id="ACT23582.1"
FT                   /translation="MSAWFNYTATLKILIFSLLAGALLPGLFAVGVRLQAAGDGADATA
FT                   RRRPLLVAVSWAIFALVLAVVIIGVLYIARDFIAHHTGWAFLGATPK"
     gtgagtgcct ggttcaacta cacggccacc ctgaagatcc tgatcttcag tctgctagcc        60
     ggcgcgctgc taccgggcct gttcgcggtg ggcgtgcggc tgcaggccgc cggcgacggt       120
     gccgacgcca ccgcgcgccg gcgcccgctg ctggttgccg tcagttgggc gatcttcgcg       180
     ctggtgcttg cggtagtcat cattggagtg ctgtatatcg cccgtgactt catcgcgcat       240
     cacaccggct gggccttcct gggcgccaca cccaagtag                              279
//

If you have problems or comments...

PBIL Back to PBIL home page