(data stored in ACNUC7421 zone)

EMBL: CP001658.PE562

CP001658.PE562       Location/Qualifiers
FT   CDS_pept        complement(636471..637724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00551"
FT                   /product="low affinity inorganic phosphate transporter
FT                   membrane protein pitA"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00551"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23583"
FT                   /protein_id="ACT23583.1"
FT                   /translation="MNLQLFLLLIVVVTALAFDFTNGFHDTGNAMATSIASGALAPRVA
FT                   VALSAVLNLIGAFLSTAVAATIAKGLIDANLVTLELVFAGLVGGIVWNLLTWLLGIPSS
FT                   SSHALIGGIVGATIAAVGLRGVIWSGVVSKVIVPAVVAALLATLVGAVGTWLVYRTTRG
FT                   VAEKRTERGFRRGQIGSASLVSLAHGTNDAQKTMGVIFLALMSYGAVSTTASVPPLWVI
FT                   VSCAVAMAAGTYLGGWRIIRTLGKGLVEIKPPQGMAAESSSAAVILLSAHFGYALSTTQ
FT                   VATGSVLGSGVGKPGAEVRWGVAGRMVVAWLVTLPLAGLVGAFTYGLVHFIGGYPGAIL
FT                   GFALLWLTATAIWLRSRRAPIDHTNVNADWEGNLTAGLEAGAQPLADQRPPVPAPPAPT
FT                   PPPNHRAPQFGVTTRNAP"
     gtgaaccttc agttgttcct tttgctcatt gtcgtcgtga cggcattggc gttcgacttc        60
     accaacgggt tccacgacac cggaaacgcc atggcgacct cgattgccag cggcgccctg       120
     gcaccgcggg tagcggtagc actttctgcc gtgctgaacc tgatcggtgc gtttttgtcc       180
     accgccgtgg cggccacaat cgccaagggt ctgatcgacg cgaatctggt gacgctggag       240
     ttggtgttcg ccggcctggt cggcgggatc gtctggaacc tgttgacctg gttgctgggc       300
     attccgtcga gttcctcaca tgcgctgatc ggcggcatcg tcggcgccac aattgccgcc       360
     gtcggcctgc gtggggtgat ctggagcgga gtggtgtcca aggtgatcgt gccggccgtg       420
     gtagccgcgc tgctggccac gctggtcgga gcagtcggca cctggctggt ctaccggacg       480
     acgcgcgggg ttgccgaaaa gcgtacggaa cgcggtttcc ggcgcggcca gatcggctcg       540
     gcgtcgctgg tctcgctggc gcacggcacc aacgacgcgc agaagacgat gggcgtgatc       600
     ttcctggcgt tgatgtccta cggcgcggtc agcacgacgg catcggtgcc gccgctgtgg       660
     gtgatcgtga gttgcgccgt ggccatggcc gccggtacct acctgggtgg ctggcgcatc       720
     atccgcaccc taggcaaagg gctggtcgag atcaaaccac cgcagggtat ggccgccgag       780
     tcgtcatcgg ccgccgtcat tctgttgtcc gcgcacttcg gctatgcgct gtccacaacg       840
     caggtcgcga ccgggtccgt gctgggcagc ggcgtcggca agcccggcgc cgaggtgcgc       900
     tggggggtag ccggccgcat ggtggtcgcg tggctggtga cgctcccgtt ggccgggctg       960
     gtcggggcct tcacctacgg gctggtgcat ttcatcggtg gctaccccgg tgcgatcctc      1020
     ggtttcgcac tgttgtggct gaccgccacc gccatctggc tgcggtcgcg cagggcgccg      1080
     atcgaccaca ccaacgtcaa cgccgactgg gaaggcaacc tgacggccgg cctggaagcg      1140
     ggtgcgcagc cgcttgcgga tcagaggccg ccggtgcctg caccgccggc tccgactccc      1200
     ccaccgaacc accgagcacc acagttcggc gtcaccacga ggaacgcccc gtga            1254
//

If you have problems or comments...

PBIL Back to PBIL home page