(data stored in ACNUC7421 zone)

EMBL: CP001658.PE583

CP001658.PE583       Location/Qualifiers
FT   CDS_pept        complement(657809..658300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00571"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00571"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23604"
FT                   /protein_id="ACT23604.1"
FT                   /translation="MADSSFDIVSKVDRQEVDNALNQAAKELATRFDFRGTDTKIAWKG
FT                   DEAVELTSSTEERVKAAVDVFKEKLIRRDISLKAFEAGEPQASGKTYKVTGALKQGISS
FT                   ENAKKITKLIRDAGPKNVKTQIQGDEVRVTSKKRDDLQAVIAMLKKADLDVALQFVNYR
FT                   "
     atggcggact catcgttcga catcgtcagc aaggtcgacc ggcaggaggt cgacaacgca        60
     ctcaaccagg ccgccaagga gctggccacg cgcttcgact tccgcggcac cgacaccaag       120
     atcgcgtgga agggcgacga ggccgtcgag ctcacctcgt ccaccgagga gcgtgtcaag       180
     gccgccgtcg acgtcttcaa ggagaagctg atccgccgcg acatctcgct gaaggccttc       240
     gaggccggag aaccgcaggc ctcgggtaag acgtacaaag ttaccggcgc cctcaaacag       300
     ggcattagca gcgagaacgc caagaagatc accaagctca tccgcgacgc aggccccaag       360
     aacgtcaaaa cccagatcca gggcgacgag gtccgggtca ccagcaagaa gcgcgacgac       420
     ctgcaggccg tcatcgccat gctgaagaag gccgacctgg atgtggcatt gcagtttgtg       480
     aactaccgct ag                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page