(data stored in ACNUC7421 zone)

EMBL: CP001658.PE586

CP001658.PE586       Location/Qualifiers
FT   CDS_pept        661195..661530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00574"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00574"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23607"
FT                   /protein_id="ACT23607.1"
FT                   /translation="MAYCPPAVAPGACTIEVPKEGTLMKAKVGDWLVIKGATIDQPDHR
FT                   GLIIEVRSSDGSPPYVVRWLETDHVATVIPGPDAVVVTAEEQNAADERAQHRFGAVQSA
FT                   ILHARGT"
     gtggcctact gccctcccgc cgttgcgccg ggtgcgtgca cgattgaagt ccccaaggaa        60
     gggacgctca tgaaggcaaa ggtcggggac tggctggtga tcaaaggcgc gacgatagat       120
     caaccggacc accgagggtt gattattgag gtgcgctcat ccgatggttc gccgccgtat       180
     gtggtgcgct ggctcgagac cgaccatgtg gcgacggtga ttccgggtcc ggatgcggtc       240
     gtggtcactg cggaggagca gaatgcggcc gacgagcggg cgcagcatcg gttcggcgcg       300
     gttcagtcgg cgatcctcca tgccagggga acgtag                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page