(data stored in ACNUC7421 zone)

EMBL: CP001658.PE587

CP001658.PE587       Location/Qualifiers
FT   CDS_pept        661514..663634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00575"
FT                   /product="ribonucleoside-diphosphate reductase large
FT                   subunit nrdZ"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00575"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23608"
FT                   /protein_id="ACT23608.1"
FT                   /translation="MPGERRRFAQATKSVGVSWPAKVRRRDGTLVPFDIARIEAAVTRA
FT                   AREVACDDPDMPGTVAKAVADALGRGIAPVEDIQDCVEARLGEAGLDDVARVYIIYRQR
FT                   RAELRTAKALLGVRDELKLSLAAVTVLRERYLLHDEQGRPAESTGELMDRSARCVAAAE
FT                   DQYEPGSSRRWAERFATLLRNLEFLPNSPTLMNSGTDLGLLAGCFVLPIEDSLQSIFAT
FT                   LGQAAELQRAGGGTGYAFSHLRPAGDRVASTGGTASGPVSFLRLYDSAAGVVSMGGRRR
FT                   GACMAVLDVSHPDICDFVTAKAESPSELPHFNLSVGVTDAFLRAVERNGLHRLVNPRTG
FT                   KIVARMPAAELFDAICKAAHAGGDPGLVFLDTINRANPVPGRGRIEATNPCGEVPLLPY
FT                   ESCNLGSINLARMLADGRVDWDRLEEVAGVAVRFLDDVIDVSRYPFPELGEAARATRKI
FT                   GLGVMGLAELLAALGIPYDSEEAVRLATRLMRRIQQAAHTASRRLAEERGAFPAFTDSR
FT                   FARSGPRRNAQVTSVAPTGTISLIAGTTAGIEPMFAIAFTRAIVGRHLLEVNPCFDRLA
FT                   RDRGFYRDELIAEIAQRGGVRGYPRLPAEVRAAFPTAAEIAPQWHLRMQAAVQRHVEAA
FT                   VSKTVNLPATATVDDVRAIYVAAWKAKVKGITVYRYGSREGQVLSYAAPKPLLAQADTE
FT                   FSGGCAGRSCEF"
     atgccagggg aacgtaggcg attcgctcaa gcgacgaagt cggtgggtgt cagctggccg        60
     gcgaaagtcc ggcgccggga tggaacgctg gtgccgttcg acatcgcgcg gatcgaagca       120
     gcggtgacgc gggcagcgcg cgaggtggct tgcgacgacc ccgatatgcc gggcaccgta       180
     gcgaaagccg tcgccgacgc actcgggcgc ggtatcgctc ccgttgagga cattcaggac       240
     tgcgtggagg cccggctggg ggaagccggt ctggatgacg tggcccgtgt ttacatcatc       300
     taccggcagc ggcgcgccga gctgcggacg gctaaggcct tgctcggcgt gcgggacgag       360
     ttaaagctga gcttggcggc cgtgacggta ctgcgcgagc gctatctgct gcacgacgag       420
     cagggccggc cggccgagtc gaccggcgag ctgatggacc gatcggcgcg ctgtgtcgcg       480
     gcggccgagg accagtatga gccgggctcg tcgaggcggt gggccgagcg gttcgccacg       540
     ctattacgca acctggaatt cctgccgaat tcgcccacgt tgatgaactc tggcaccgac       600
     ctgggactgc tcgccggctg ttttgttctg ccgattgagg attcgctgca atcgatcttt       660
     gcgacgctgg gacaggccgc cgagctgcag cgggctggag gcggcaccgg atatgcgttc       720
     agccacctgc gacccgccgg ggatcgggtg gcctccacgg gcggcacggc cagcggaccg       780
     gtgtcgtttc tacggctgta tgacagtgcc gcgggtgtgg tctccatggg cggtcgccgg       840
     cgtggcgcct gtatggctgt gcttgatgtg tcgcacccgg atatctgtga tttcgtcacc       900
     gccaaggccg aatcccccag cgagctcccg catttcaacc tatcggttgg tgtgaccgac       960
     gcgttcctgc gggccgtcga acgcaacggc ctacaccggc tggtcaatcc gcgaaccggc      1020
     aagatcgtcg cgcggatgcc cgccgccgag ctgttcgacg ccatctgcaa agccgcgcac      1080
     gccggtggcg atcccgggct ggtgtttctc gacacgatca atagggcaaa cccggtgccg      1140
     gggagaggcc gcatcgaggc gaccaacccg tgcggggagg tcccactgct gccttacgag      1200
     tcatgtaatc tcggctcgat caacctcgcc cggatgctcg ccgacggtcg cgtcgactgg      1260
     gaccggctcg aggaggtcgc cggtgtggcg gtgcggttcc ttgatgacgt catcgatgtc      1320
     agccgctacc ccttccccga actgggtgag gcggcccgcg ccacccgcaa gatcgggctg      1380
     ggagtcatgg gtttggcgga actgcttgcc gcactgggta ttccgtacga cagtgaagaa      1440
     gccgtgcggt tagccacccg gctcatgcgt cgcatacagc aggcggcgca cacggcatcg      1500
     cggaggctgg ccgaagagcg gggcgcattc ccggcgttca ccgatagccg gttcgcgcgg      1560
     tcgggcccga ggcgcaacgc acaggtcacc tccgtcgctc cgacgggcac catctcactg      1620
     atcgccggaa ccaccgcggg catcgagccg atgttcgcta tcgcgttcac ccgcgccatc      1680
     gtcggccggc atctgctgga ggtcaatccg tgcttcgacc gactggcccg cgatcggggc      1740
     ttttatcgtg acgagctgat cgccgagatc gctcagcgtg gcggagtccg tggctatccg      1800
     cggctgcctg ctgaggtgcg ggccgcgttc ccgaccgcgg cggagatcgc gccgcagtgg      1860
     catctgcgca tgcaggccgc ggtgcagcgc cacgtcgagg ccgccgtgtc caagacggtc      1920
     aacttgcccg ccacggcgac ggtcgatgac gtccgcgcca tctatgtggc cgcctggaag      1980
     gcaaaggtca agggcatcac ggtgtatcgc tacggcagcc gggaaggaca ggtactgtcc      2040
     tacgccgcgc cgaaaccgct actggcgcag gctgacacgg agttcagcgg cggctgtgcg      2100
     ggccgctcct gcgagttctg a                                                2121
//

If you have problems or comments...

PBIL Back to PBIL home page