(data stored in ACNUC7421 zone)

EMBL: CP001658.PE589

CP001658.PE589       Location/Qualifiers
FT   CDS_pept        complement(665303..665644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00577"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00577"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23610"
FT                   /protein_id="ACT23610.1"
FT                   /translation="MGEHAIKRHMRQRKPTKHPLAQKRGARILVLTDDPRRSVLIVPGC
FT                   HLDSMRREKNAYYFQDGNALVGMVVSGGTVEYDADDRTYVVQLTDGRHTTESSFEHSSP
FT                   SRSPQSDDL"
     atgggtgagc acgccatcaa gcggcacatg cggcaacgga agcctacgaa gcatccccta        60
     gcccagaaac ggggcgcgcg gattctggtc ctcaccgacg atccccgcag gagcgtcctc       120
     atagtgcccg gttgccacct ggattccatg cgccgagaaa agaacgcgta ctacttccag       180
     gacggcaatg cgttggttgg gatggttgtc tcgggcggca cggttgagta cgacgccgac       240
     gaccgcacat atgtcgtgca gctcaccgac ggaaggcaca ccactgagtc atctttcgaa       300
     cactcatcgc cgagtcgatc acctcaatcc gatgacctat ga                          342
//

If you have problems or comments...

PBIL Back to PBIL home page