(data stored in ACNUC7421 zone)

EMBL: CP001658.PE596

CP001658.PE596       Location/Qualifiers
FT   CDS_pept        complement(672257..676168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_03991"
FT                   /product="PE-PGRS family protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_03991"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23617"
FT                   /protein_id="ACT23617.1"
FT                   /translation="MSFVIATPEMLTTAATDLAKIGSTITAANTAAAAVAKVLPASADE
FT                   VSVAVAALFGTHAQEYQTVSAQVATFHDRFVQTLSATASSYVAAEAVNVEQSLLAAVNA
FT                   PTQALFGRPLIGNGADGSPGTGQAGGPGGILYGNGGNGGSGAPGQRGGAGGAAGLIGNG
FT                   GNGGAGGVGTTGGAGGHGGAGGWLYGNGGAGGFGGAGAVGGNGGAGGTAGLFGVGGAGG
FT                   AGGNGIAGVTGTSASTPGGSGTAGGAGGIGGNGGAGGAGGVLMGNGGNGGAGGEGGPGG
FT                   AGGAGASGAHATNLGADGQAGGNGGNGGAGGTGGVGGPGGGHGLLGLGGSHGAGGAGGS
FT                   GGDGGAPGDGGNGATGTWGHNLGAGGTGGNGGNPGAGGAGGAGGASVGGSAHGANGAPG
FT                   TTSTSGGNGGDGGKGADAISSGQTGANGGRGGDGGQVGNGGAGGAGGRGGAGGLGFGSE
FT                   APGRPGGAGGTGGAGGNGGTQAGDGGTGGAGGAGGDGGSGGAGSIGFNASAPGAAGSPG
FT                   GNGGNGGPGGAGGEGGAGGLALAASGQNGSQGAGGDGGAGGNGGTPGNGGHGAAGALGV
FT                   NGGVGGAGGHGGDPGVGGAGGQGGSGSTPGANGAPGNTPTSGGNGGNGGRGADATGFGQ
FT                   TGASGGRGGDGGLVGNGGAGGAGGNGSKGLPGLGRLGNPGLDGGTGGNGGAGGSGGAWA
FT                   GNGGTGGAGGTGGVGGTGGSGSDGVNGSSAGADGHPGGTGGVGGTGGKGGDGGDGGAAP
FT                   NGVAGSQGPGGAGGDGGTGGVGGNGGRGIDGADGATAGARGQDGGAGGAGGKGGRGGTG
FT                   GPGGAGPAGTTGSQGAGGNGGSGGTGGDPGDGGNGANGSVFTNNGIGGNGGNGGNAGPS
FT                   GAGGSGGAGSTFGATGSSSSIHVNGGNGGNGGNGDHALSGNGAAGGNGGNGGNGSLRGS
FT                   GGAGGHGGNGGNASRGMGGDGGTGGAGGNAGQIGNGGAGGNGGDGGTGSDGNPGAITGS
FT                   GGRGGDGGVGGQGGSVAGDGADGGRGGAGGTGGTGLRGTTGATGATGTFDAGADGHGGN
FT                   GGTGGVGGTGGAGGGGGNGGAGGKALSPTGNNGSQGAGGDGGAGGAGGTGGTGGDGGRG
FT                   AHGTLFSSLAGTGGTGGNGGTGGTGGAGGAGGTGSTLGATGATGAAGRAGNGGVGGSGG
FT                   LGSAFGPGGTGGMGGAGGTSTVSAGGDGGRGGFGGDGLDASSGGNGGDGGHGGDGFRTA
FT                   GAGGRGGDGGKGADPGGLFPIPGAGGKGGTGGTGGTAHLGPLAIIGQSGQPGQFGSPGA
FT                   DGRGGAGGAGGGGGAGGSF"
     atgtcgttcg taatcgcgac gccggagatg ctgaccacgg cggcaacgga tttggcgaaa        60
     attggttcga cgatcactgc ggccaacacc gcagcggccg cggtggcgaa agtgctgccc       120
     gcgtcagccg acgaggtgtc ggtggccgtt gcggcgttgt tcggcacgca cgcccaggaa       180
     tatcagaccg tcagcgccca agtggcgacg tttcatgacc ggttcgtgca gaccctgtcc       240
     gcgaccgcga gctcgtacgt ggccgccgag gcggtcaacg ttgaacagag tttgctagcc       300
     gcggtcaatg cgcccaccca ggcgctgttc ggacgcccgc tgatcggcaa cggcgccgac       360
     ggctcccccg ggaccgggca ggccggcggg ccaggcggca tcttgtacgg caacggcggc       420
     aacggcgggt ctggggcgcc aggacaacga ggcggggccg gcggggcggc gggcctaatc       480
     ggtaacggcg gcaacggtgg agccggcggc gtgggtacca ccggcggggc cggtggtcac       540
     ggcggcgcgg gcgggtggct gtatggcaac ggaggcgccg ggggttttgg cggggccggg       600
     gcggtcggcg gcaacggcgg ggccggcggt accgccgggt tgttcggtgt cggcggggcc       660
     ggtggggccg gaggcaacgg catcgccggt gtcacgggta cgtcggccag cacaccgggt       720
     ggatccggca ccgctggcgg ggccggcggg atcggcggca acggcggggc cggcggggcc       780
     ggcggggtgc tgatgggcaa cggcggcaac ggcggggccg gcggcgaggg cgggcccggc       840
     ggcgccggcg gtgcgggcgc cagcggcgcc cacgccacca acttgggcgc tgacggtcaa       900
     gccggcggaa acggcgggaa tggtggggct ggcgggaccg gcggggtcgg cgggcccggc       960
     ggcggccacg gtctgctcgg cctcggcggc agccacggcg ccggcggggc tggcggtagc      1020
     ggcggtgacg gcggagctcc cggtgacggc ggcaacggcg ctaccgggac gtggggtcac      1080
     aaccttggtg ccggcgggac cggtggcaat ggcggcaacc cgggcgccgg tggggccggt      1140
     ggcgccggtg gcgccagcgt cggcggcagc gcgcatggcg cgaacggcgc gcccggcacc      1200
     acctccacca gcggtggtaa cggcggcgac ggcggcaaag gcgccgacgc tatcagcagc      1260
     ggacagaccg gcgcgaacgg tggcaggggt ggcgacggcg gtcaggtggg taatggcggt      1320
     gccggtgggg ccggtggccg cggcggggcc ggcggtctcg gatttggatc cgaagcgccc      1380
     ggtcgccccg gcggggccgg cggcaccggc ggggccggcg gcaacggcgg aactcaggcc      1440
     ggtgacggcg gcaccggagg tgctggcggg gccggcggcg atggcggatc cggaggtgct      1500
     ggcagcatcg gcttcaatgc gtccgctccc ggggccgcag gctcacccgg cgggaatggc      1560
     ggtaacggtg ggcctggcgg agccggcggc gagggcgggg ccggcggtct cgcgttggcc      1620
     gcctcgggcc agaacggcag ccagggcgct ggcggtgacg gcggagccgg cgggaacggc      1680
     gggactcctg gcaacggcgg tcacggcgcc gccggcgcgc tcggtgtcaa cggtggtgta      1740
     ggtggcgccg gtggccacgg cggtgatccc ggtgtcggcg gtgccggcgg ccagggcgga      1800
     agcggctcca cccccggtgc caacggcgca cccggcaaca cccccaccag cggcggcaac      1860
     ggcggcaacg gcggcagagg cgccgatgcc accggctttg gccagaccgg cgcgtccggc      1920
     ggcaggggcg gtgatggcgg tttggtcggc aacggcggcg ccggcggcgc cggcggcaac      1980
     ggcagcaaag gcctgcccgg tctgggcagg ctcggcaacc ccggcctgga tggcggcacc      2040
     ggcggaaacg gtggggccgg tggatccggc ggcgcctggg cgggcaacgg tggcaccggc      2100
     ggggccggcg gcaccggcgg cgtcggcggg actggagggt ccggcagcga cggtgtcaac      2160
     ggttccagcg cgggcgcgga cgggcacccc ggcggcaccg gcggagttgg cggtaccggc      2220
     ggaaaaggtg gggacggcgg ggacggcggg gccgcaccca acggcgtcgc cggcagccaa      2280
     ggccccggcg gtgccggcgg cgacggtggg accggcggag ttggcggtaa cggcggccgc      2340
     ggcattgacg gcgccgacgg cgccaccgcg ggtgcccgcg gccaggatgg cggcgccggc      2400
     ggggccggcg gaaagggcgg ccgaggcggg accggcgggc cgggcggggc cgggccggcg      2460
     ggcacaaccg gcagccaagg cgccggcggc aacggcggca gcggcggcac cggcggggac      2520
     cccggtgacg gcggcaacgg cgctaacggc agcgtgttca ccaacaacgg catcggcggc      2580
     aacggcggca acggcggcaa cgccggcccc agcggggccg gcgggagtgg cggcgccggc      2640
     tccactttcg gtgcgaccgg ctcaagcagc agcattcacg tcaacggcgg caacggcggc      2700
     aacggcggca acggcgacca tgccctcagc ggcaacggcg cggccggcgg caacggcggc      2760
     aacggcggca acggcagcct gcgcggcagc ggtggggccg gcggccacgg cggcaacggc      2820
     ggcaatgcca gcaggggcat gggcggtgac ggcggaaccg gtggcgccgg cggaaacgcc      2880
     gggcagattg gcaacggcgg agcgggcggc aatggcggag acggcggcac cggtagtgac      2940
     ggcaatcccg gagccattac cggcagcggc ggccgcggcg gcgacggcgg cgtaggcggg      3000
     caaggtggga gcgtcgccgg cgacggcgct gacggcggcc ggggcggggc cggcggcacg      3060
     ggcgggacgg gcctgcgggg caccaccggc gccaccggtg cgaccggcac attcgacgct      3120
     ggcgcggacg gtcacggcgg taacggtggc accggcgggg ttggcgggac cggcggcgcc      3180
     ggcggcggcg gcggcaacgg cggggccggc ggcaaagcgc tgtcgccaac gggcaacaac      3240
     ggcagccaag gcgccggcgg agatggtggg gccggtggcg ccggcggcac cggcggcacc      3300
     ggcggcgacg gcggcagagg tgcccacggc actctcttca gcagcctcgc tggcactggc      3360
     gggactggcg gaaatggcgg caccggcggc accggtggtg ccggcggtgc cggcggcacc      3420
     ggttccaccc tgggcgcgac cggtgcgaca ggggcggccg gccgcgccgg aaacggtggc      3480
     gtcggcggca gtggcggcct tggctccgcc tttggccccg gcggcaccgg cggcatgggc      3540
     ggcgccggcg gcaccagcac cgtcagcgcc ggcggtgacg gcggaagggg cggcttcggc      3600
     ggcgacggcc ttgatgccag ttccggtggg aatggcgggg acggcgggca cggtggcgac      3660
     ggcttcagga ccgctggggc gggcgggcga ggtggggacg gcggcaaagg ggccgacccc      3720
     ggcggtttat tcccgatccc tggggctggc ggtaagggtg gcaccggtgg caccggcggc      3780
     accgcacacc tcgggcccct ggccatcatc ggccaatccg gccagcccgg ccagttcggc      3840
     agccccggcg ccgacggccg cggcggggcc gggggcgcag gcgggggcgg cggcgccggc      3900
     ggcagcttct ag                                                          3912
//

If you have problems or comments...

PBIL Back to PBIL home page