(data stored in ACNUC7421 zone)

EMBL: CP001658.PE6

CP001658.PE6         Location/Qualifiers
FT   CDS_pept        7404..9920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00006"
FT                   /product="DNA gyrase subunit A gyrA"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00006"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23027"
FT                   /protein_id="ACT23027.1"
FT                   /translation="MTDTTLPPDDSLDRIEPVDIQQEMQRSYIDYAMSVIVGRALPEVR
FT                   DGLKPVHRRVLYAMFDSGFRPDRSHAKSARSVAETMGNYHPHGDASIYDTLVRMAQPWS
FT                   LRYPLVDGQGNFGSPGNDPPAAMRYTEARLTPLAMEMLREIDEETVDFIPNYDGRVQEP
FT                   TVLPSRFPNLLANGSGGIAVGMATNIPPHNLRELADAVFWALENHDADEEETLAAVMGR
FT                   VKGPDFPTAGLIVGSQGTADAYKTSRGSIRMRGVVEVEEDSRGRTSLVITELPYQVNHD
FT                   NFITSIAEQVRDGKLAGISNIEDQSSDRVGLRIVIEIKRDAVAKVVINNLYKHTQLQTS
FT                   FGANMLAIVDGVPRTLRLDQLIRYYVDHQLDVIVRRTTYRLRKANERAHILRGLVKALD
FT                   ALDEVIALIRASETVDIARAGLIELLDIDEIQAQAILDMQLRRLAALERQRIIDDLAKI
FT                   EAEIADLEDILAKPERQRGIVRDELAEIVDRHGDDRRTRIIAADGDVSDEDLIAREDVV
FT                   VTITETGYAKRTKTDLYRSQKRGGKGVQGAGLKQDDIVAHFFVCSTHDLILFFTTQGRV
FT                   YRAKAYDLPEASRTARGQHVANLLAFQPEERIAQVIQIRGYTDAPYLVLATRNGLVKKS
FT                   KLTDFDSNRSGGIVAVNLRDNDELVGAVLCSADDDLLLVSANGQSIRFSATDEALRPMG
FT                   RATSGVQGMRFNIDDRLLSLNVVREGTYLLVATSGGYAKRTAIEEYPVQGRGGKGVLTV
FT                   MYDRRRGRLVGALIVDDDSELYAVTSGGGVIRTAARQVRKAGRQTKGVRLMNLGEGDTL
FT                   LAIARNAEESGDDNAVDANGADQTGN"
     atgacagaca cgacgttgcc gcctgacgac tcgctcgacc ggatcgaacc ggttgacatc        60
     cagcaggaga tgcagcgcag ctacatcgac tatgcgatga gcgtgatcgt cggccgcgcg       120
     ctgccggagg tgcgcgacgg gctcaagccc gtgcatcgcc gggtgctcta tgcaatgttc       180
     gattccggct tccgcccgga ccgcagccac gccaagtcgg cccggtcggt tgccgagacc       240
     atgggcaact accacccgca cggcgacgcg tcgatctacg acaccctggt gcgcatggcc       300
     cagccctggt cgctgcgcta cccgctggtg gacggccagg gcaacttcgg ctcgccaggc       360
     aatgacccac cggcggcgat gaggtacacc gaagcccggc tgaccccgtt ggcgatggag       420
     atgctgaggg aaatcgacga ggagacagtc gatttcatcc ctaactacga cggccgggtg       480
     caagagccga cggtgctacc cagccggttc cccaacctgc tggccaacgg gtcaggcggc       540
     atcgcggtcg gcatggcaac caatatcccg ccgcacaacc tgcgtgagct ggccgacgcg       600
     gtgttctggg cgctggagaa tcacgacgcc gacgaagagg agaccctggc cgcggtcatg       660
     gggcgggtta aaggcccgga cttcccgacc gccggactga tcgtcggatc ccagggcacc       720
     gctgatgcct acaaaactag ccgcggctcc attcgaatgc gcggagttgt tgaggtagaa       780
     gaggattccc gcggtcgtac ctcgctggtg atcaccgagt tgccgtatca ggtcaaccac       840
     gacaacttca tcacttcgat cgccgaacag gtccgagacg gcaagctggc cggcatttcc       900
     aacattgagg accagtctag cgatcgggtc ggtttacgca tcgtcatcga gatcaagcgc       960
     gatgcggtgg ccaaggtggt gatcaataac ctttacaagc acacccagct gcagaccagc      1020
     tttggcgcca acatgctagc gatcgtcgac ggggtgccgc gcacgctgcg gctggaccag      1080
     ctgatccgct attacgttga ccaccaactc gacgtcattg tgcggcgcac cacctaccgg      1140
     ctgcgcaagg caaacgagcg agcccacatt ctgcgcggcc tggttaaagc gctcgacgcg      1200
     ctggacgagg tcattgcact gatccgggcg tcggagaccg tcgatatcgc ccgggccgga      1260
     ctgatcgagc tgctcgacat cgacgagatc caggcccagg caatcctgga catgcagttg      1320
     cggcgcctgg ccgcactgga acgccagcgc atcatcgacg acctggccaa aatcgaggcc      1380
     gagatcgccg atctggaaga catcctggca aaacccgagc ggcagcgtgg gatcgtgcgc      1440
     gacgaactcg ccgaaatcgt ggacaggcac ggcgacgacc ggcgtacccg gatcatcgcg      1500
     gccgacggag acgtcagcga cgaggatttg atcgcccgcg aggacgtcgt tgtcactatc      1560
     accgaaacgg gatacgccaa gcgcaccaag accgatctgt atcgcagcca gaaacgcggc      1620
     ggcaagggcg tgcagggtgc ggggttgaag caggacgaca tcgtcgcgca cttcttcgtg      1680
     tgctccaccc acgatttgat cctgttcttc accacccagg gacgggttta tcgggccaag      1740
     gcctacgact tgcccgaggc ctcccggacg gcgcgcgggc agcacgtggc caacctgtta      1800
     gccttccagc ccgaggaacg catcgcccag gtcatccaga ttcgcggcta caccgacgcc      1860
     ccgtacctgg tgctggccac tcgcaacggg ctggtgaaaa agtccaagct gaccgacttc      1920
     gactccaatc gctcgggcgg aatcgtggcg gtcaacctgc gcgacaacga cgagctggtc      1980
     ggtgcggtgc tgtgttcggc cgacgacgac ctgctgctgg tctcggccaa cgggcagtcc      2040
     atcaggttct cggcgaccga cgaggcgctg cggccaatgg gtcgtgccac ctcgggtgtg      2100
     cagggcatgc ggttcaatat cgacgaccgg ctgctgtcgc tgaacgtcgt gcgtgaaggc      2160
     acctatctgc tggtggcgac gtcagggggc tatgcgaaac gtaccgcgat cgaggaatac      2220
     ccggtacagg gccgcggcgg taaaggtgtg ctgacggtca tgtacgaccg ccggcgcggc      2280
     aggttggttg gggcgttgat tgtcgacgac gacagcgagc tgtatgccgt cacttccggc      2340
     ggtggcgtga tccgcaccgc ggcacgccag gttcgcaagg cgggacggca gaccaagggt      2400
     gttcggttga tgaatctggg cgagggcgac acactgttgg ccatcgcgcg caacgccgaa      2460
     gaaagtggcg acgataatgc cgtggacgcc aacggcgcag accagacggg caattaa         2517
//

If you have problems or comments...

PBIL Back to PBIL home page