(data stored in ACNUC7421 zone)

EMBL: CP001658.PE603

CP001658.PE603       Location/Qualifiers
FT   CDS_pept        679481..682114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00591"
FT                   /product="hypothetical exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00591"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23624"
FT                   /protein_id="ACT23624.1"
FT                   /translation="MRARRLRRALAALLAVAGLFVPFIVGVPTAYDGEPVFVAIPVEHV
FT                   NTLIGTGTGAAIVGEINNFPGASVPFGMVQYSPDTVDNYAGYDYDNPHSTGFSMTHASV
FT                   GCPAFGDISMLPTTTPLGSQPWSAWEEIAHDDTEVGVPGYYTVRFPGTGVIAELTATTR
FT                   TGVGRFRYPRNGWPALFHVRSGASLAGNYAATLQIEDNTTITGSATSGGFCGKKNLYTV
FT                   YFAMKFSQPFSSYGTWDGYAVYPGSHSMNSSYSGGYVGFPAGSVLEVRTALSYVSVDGA
FT                   RANLDAEGGASFDDIRAATSSEWNAALSRIAVAGRGPGDVDTFYTCLYRSLLHPNTFND
FT                   VDGRYIGFDGVIHSVASGHTHYANFSDWDTYRSLAPLQGLLFPQRASDMIQSLVTDAEQ
FT                   SGAYPRWALANSATGMMSGDSVVPLIVNLYAFGARDFDLKSALHYMVNAATQGGVGLDG
FT                   FLERPGIAAYLRLGYGPQTAEFRANGRIAGASVTLEWSVDDFAISRFADSLGDTATAAV
FT                   FQNRSQYWQNLFNPTTGYISPRSAAGFFPDGPGFVAYPSGFGQDGYDEGNAEQYLWWVP
FT                   HNVAGLVTALGGRTAVVKRLDRFTKKLNVGPNEPYLWAGNEPGFGVPWLYNYIGQPWKT
FT                   QRTVDRVRGLFGPTPGGAPGNDDLGALSSWYVWAALGLYPSTPGTTILTVNTPLFDRAV
FT                   IALPTGKSIQITAPGASGRNRLKYIDGLTIDRQPSNQTFLPESIVRTGGDLTFSLAGTP
FT                   NKVWGTAASAAPPSFGAGSSAVTVNIARPIIGIVPGATGTVTVDAQRMIDGVDDYTVTP
FT                   TSYVVGIAAEPLSGQFDDDGAVSASVAITVARSVPSGYYPIYVTTSAGDSARTLIVLVV
FT                   VAEAVE"
     atgcgggcac gcaggttgcg cagagccctg gccgcgctct tggcggtggc gggtctgttt        60
     gttccgttca ttgttggcgt gcccacggcc tacgacggtg agccggtgtt cgtcgccatt       120
     ccggtcgagc atgtcaatac gctcatcggc accggcacgg gagccgcgat agtgggggag       180
     atcaacaact ttcccggcgc ctcggtgccg ttcggcatgg tgcagtactc gccggacacc       240
     gtcgacaact acgccggcta cgactacgac aacccgcatt ccaccggatt cagcatgacg       300
     cacgcgtcgg tgggctgccc ggcgttcggc gacatctcga tgttgcccac gaccaccccg       360
     ctcggctcgc agccgtggag cgcctgggag gagatcgccc acgacgacac cgaggtcggc       420
     gtgcccggct actacaccgt acggttcccc ggtaccgggg tgatcgccga gctcaccgcc       480
     accacccgca cgggcgtcgg ccggtttcgc tacccccgca atgggtggcc ggcgctgttt       540
     cacgtgcgct ccggcgcatc gttggcgggc aactacgccg cgacactgca gatcgaggac       600
     aacaccacaa tcaccggctc ggcgaccagc ggcgggttct gcggcaagaa gaacctgtac       660
     acggtgtact tcgccatgaa gttcagccag ccgttcagct cgtatggcac ctgggacggc       720
     tacgcggtct atcccggttc acacagcatg aattcgagtt acagcggggg gtatgtcggg       780
     tttccggccg gctcggtgct cgaggtgcgg accgccctgt cctatgtgag cgtggacggg       840
     gcgcgagcca acctggacgc cgaaggcgga gcaagcttcg acgacatccg tgcggcgaca       900
     tcgagcgaat ggaacgccgc gctatcgcga atcgcggtgg ccggcagggg gcctggcgac       960
     gtggacacct tctacacttg tctttaccgg tcactgttgc accccaacac ctttaacgac      1020
     gtggacggac gttacatcgg attcgacggt gtcatccaca gcgttgccag tgggcacacc      1080
     cactacgcca atttctccga ctgggacacc taccgcagcc tcgccccact gcagggactg      1140
     ttgttcccgc aacgggccag cgacatgatc cagtcgttgg tgaccgacgc ggagcagagt      1200
     ggtgcgtatc cgcgttgggc gctggcgaat tccgcaaccg gcatgatgag cggagacagt      1260
     gtggtaccgc tcatcgtaaa cctctacgcc ttcggcgcca gggatttcga cctcaaatcc      1320
     gcgctgcact acatggtgaa tgcagcgacc cagggcggtg tcggacttga cggtttcctg      1380
     gagcggccgg gaatcgccgc ctatctgagg ctcggctatg gaccacaaac ggcggaattc      1440
     cgcgccaacg gtcgtatcgc cggcgcctcg gtcacgctgg agtggtcggt cgatgacttt      1500
     gccatctccc gattcgctga ttcgttgggc gataccgcaa ctgccgccgt ctttcagaac      1560
     cggtcgcagt attggcagaa cctgttcaat cccaccaccg gctatatctc gccccggagc      1620
     gcggccggtt tcttccccga cggtcccggg ttcgtggcat acccctcggg ctttgggcag      1680
     gacggatacg acgagggcaa cgccgaacaa tacctgtggt gggtgccgca taacgtggcc      1740
     ggtttggtga ccgcgcttgg tggccgcacg gccgtcgtca agcggctcga ccgctttacc      1800
     aaaaagctca acgtcggccc caacgaaccc tatctgtggg ccggtaacga gcccggtttc      1860
     ggggtgccct ggctgtacaa ctacatcggc caaccgtgga aaacccagcg gacggtcgac      1920
     cgggtccgcg ggctgttcgg cccgacacct ggcggtgcgc cgggcaacga cgacctcggc      1980
     gccctgtcca gctggtatgt ctgggctgcc cttggcctgt atccgagcac cccgggaacc      2040
     accatcctga ccgtgaacac accgcttttc gatcgcgccg tgatcgcgct ccccaccgga      2100
     aagtccattc agatcaccgc gccgggcgca tccgggcgga accgcctgaa gtacatcgac      2160
     ggcctgacca tcgaccgcca accgagcaac cagacgtttc ttccggagtc gatcgtgcgc      2220
     accggaggcg acctgacctt ctcgctcgcc ggcacaccca acaaggtctg gggaaccgcg      2280
     gcgtctgccg cgccgccgtc attcggtgcg ggcagctcgg cggtgacggt aaatatcgcc      2340
     cggcccatca tcgggatcgt gccgggagcg accgggaccg tgaccgtcga cgcgcaacgg      2400
     atgatcgacg gcgtcgacga ctacactgtc accccaacgt cctacgttgt tgggattgcg      2460
     gcggaaccgt tatccgggca attcgacgat gacggagccg tgagcgcgtc ggtcgcgatc      2520
     accgtagctc gatcggtgcc gtcggggtat tacccgatct atgtcaccac cagcgccggg      2580
     gatagtgccc ggacattgat cgtgctggtc gtggtcgccg aggcggtgga atga            2634
//

If you have problems or comments...

PBIL Back to PBIL home page