(data stored in ACNUC7421 zone)

EMBL: CP001658.PE604

CP001658.PE604       Location/Qualifiers
FT   CDS_pept        complement(682137..684524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00592"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00592"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23625"
FT                   /protein_id="ACT23625.1"
FT                   /translation="MRVDGRDIGVSGNLLQPLTRRTNDIIRAVLAAIYLVAVITSSLIT
FT                   RPQWVALEKSISEIVGVLSPSQSDLVYLGYGLAILALPFVILIGLIVSRQWKLLGAYAA
FT                   AGLMAVLPLSISSSRIAAPRWHFDLSDRLATLLAQFLDDPRWIAMLAAVLTVSGPWLPA
FT                   RWRHWWWALLLAFVPIHLVVSAIVPARSLLGLAVGWLVGALVVLVVGTPALEVPLDGAI
FT                   RALAKRGFAVSGLAVVRPAGPGPLVLSAACEQPNAGACSEALIELYGPHQSGGGALRQL
FT                   WLKLTLRGTETAPLQASMRRAVEHRALMAIAFGDLGMANTTVIAVSPLDRGWTLYAHRP
FT                   ARGIGISECTKTTPTAHVWEALRTLHDQQISHGDLCSAEITVDNGAVLFGGFGEAEYGA
FT                   TDAQLQSDLAQLLVTTSALYDAEAAVTAAIDTFGKQAILAASRRLTKSAVPKRIRESIT
FT                   DPNAVIASTRAEVMRQTGADQIKAETITRFSRGQLIQLVLIGALVYVAYPFISTVPTFF
FT                   SQLRTANWWWALLGLAVSALTYVGAAAALWACADGLVGFWKLSIMQVANTFAATTTPAG
FT                   VGGLALSTRFLQKGGLTAVRATAAVALQQSVQVIVHLVLLILFSALAGTSTDLSHFVPN
FT                   ATVLYLIAGVALGIVGTFLFVPKLRRWLATAVRPKLREVTNDLIALAREPKRLALIVLG
FT                   CAGTTLGAALALWASIEAFGGGTTFVTVTVVTMVGGTLASAAPTPGGVGAVEAALIGGL
FT                   AAFGVPAALGVPSVLLYRLLTCWLPVFAGWQVMHWLTRHEMI"
     atgcgagttg acggacgcga catcggcgtt tccggtaact tgctgcaacc actgacccgg        60
     cgcaccaacg acatcatccg ggcggtgctg gcggcgatct acctcgtggc ggtgatcacg       120
     agttcgctga tcacccgccc gcagtgggtg gcgctggaga aatccatctc ggagatcgtc       180
     ggggtgctgt ccccgtcgca atccgatctg gtgtacctgg ggtacggcct ggcgattttg       240
     gcgttgccgt tcgtgatcct gattggcctg atcgtttccc ggcagtggaa gctgctgggc       300
     gcgtatgcgg ccgccggact tatggccgtt ctcccgttgt cgatcagcag tagccgcatc       360
     gcggcacccc gatggcactt tgacctttcc gaccggctcg ccacattgct ggcccagttt       420
     ctcgatgacc cgcgatggat cgcgatgctc gcggcggtgc tcaccgtgtc gggtccctgg       480
     ctgcccgcgc gctggcggca ctggtggtgg gcgctgctgt tggcattcgt gccgatccat       540
     ctggttgtca gcgcgattgt gccggcccgc tcattgttgg ggctggcggt ggggtggttg       600
     gtcggcgcgt tggtggtcct ggtcgtcggc acaccagcgc ttgaagtgcc actggatggt       660
     gccattcgcg cgttggcaaa acgcggattc gcggtgtccg ggctcgcggt tgtgcggccg       720
     gccgggcccg ggccactggt actgtcggcc gcttgcgagc agcccaacgc cggggcgtgc       780
     agcgaggcat tgatcgagtt gtacggcccg caccaaagtg gcggcggcgc gctgcgccaa       840
     ctctggctga agctgacgtt gcgcggcacc gagaccgcac ccctgcaagc ctccatgcgc       900
     cgtgcggtcg agcatcgcgc gctgatggcc attgccttcg gcgatctagg catggccaac       960
     acgacggtga tcgcggtgtc cccgctcgac cggggatgga cgttgtatgc acaccggccc      1020
     gctcgcggaa tcggcatcag cgaatgcacc aaaaccacgc cgactgccca tgtctgggag      1080
     gcgctacgga ccctgcacga ccagcagatc tcccacgggg acctgtgtag tgccgagatc      1140
     accgtcgaca acggcgcggt gctgttcggc gggttcggtg aggccgagta cggcgccacc      1200
     gacgcccaac tccaatccga cctggcccaa ctcttggtga cgacgtcggc gctgtatgac      1260
     gccgaggccg ccgtgaccgc agccattgac acgttcggca agcaagccat cctggcggca      1320
     tcgcgaagac ttaccaaatc cgctgtgcca aaacgaatcc gagagtcgat aaccgaccca      1380
     aatgcggtca tcgccagcac acgcgccgag gtgatgcggc aaacgggcgc ggatcagatc      1440
     aaagccgaaa cgatcacccg gttcagccgc ggccagctca ttcaactggt gttaatcggt      1500
     gctctggtct atgtcgctta ccctttcatc agtaccgtgc ccacgttctt ttcccagctg      1560
     cgaaccgcga actggtggtg ggcgctactg ggcctagcgg tgtcggcgct gacgtatgtc      1620
     ggtgcggcag cggcgttgtg ggcctgcgct gatgggctgg tgggcttctg gaagctgtca      1680
     atcatgcagg tagccaacac ttttgctgca acgactaccc cggccggcgt cggcgggcta      1740
     gcgttgagta cccggttctt gcagaaggga gggctgaccg cagtgcgggc caccgcggcg      1800
     gtggcactgc agcagtcggt acaggtgatc gtccacctcg tgctgctgat cctgttcagc      1860
     gccctggccg gcacctcgac cgacctatct catttcgtcc cgaatgccac ggtgctctac      1920
     ctcattgccg gtgtggccct aggcattgtc gggacattcc tcttcgtgcc gaagctgcga      1980
     cgctggctag cgacggcggt gcggccgaag ctcagggagg taacgaatga cctcattgcg      2040
     ttggcccggg agccgaagcg actggcgttg atcgtactcg gttgtgccgg aacgacgctc      2100
     ggagctgcgt tggcactgtg ggccagtatc gaagcctttg gcggcggaac gacgttcgtc      2160
     acggtgaccg tggtgacgat ggtcggcggc accctcgcct cggccgcccc caccccgggc      2220
     ggggttggcg cggtggaggc ggcgctgatc ggtgggctcg ccgccttcgg tgtacctgca      2280
     gcattgggtg tgccgtcggt gctgctgtat cgactattga cctgttggct accggtattc      2340
     gccggctggc aggtgatgca ctggctgacc agacacgaaa tgatctaa                   2388
//

If you have problems or comments...

PBIL Back to PBIL home page