(data stored in ACNUC7421 zone)

EMBL: CP001658.PE606

CP001658.PE606       Location/Qualifiers
FT   CDS_pept        685381..686178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00594"
FT                   /product="hypothetical membrane protein yrbE2A"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00594"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23627"
FT                   /protein_id="ACT23627.1"
FT                   /translation="MTTHAVIITYLRDQTQPAVDAIGGFYRTCVLTGKALVRRPFHWRE
FT                   AIEQGWFITSVSLLPTLAVSIPLTVLIIFTLNILLAEFGAADISGAGAALGAVTQLGPL
FT                   TTVLVIAGAGATAICADLGARTIREEIDAMEVLGIDPIHRLVVPRVVAATIVAALLNGA
FT                   VITIGLVGGFVFSVFIQHVSAGAYVGTLTLVTGLPEVIISVVKSATFGLIAGLVGCYRG
FT                   LTTKGGPKGVGTAVNETLVLCVIALFATNVVLTTIGVRFGTGH"
     atgaccaccc acgccgtgat catcacctat ctccgcgacc agacgcagcc cgccgtcgat        60
     gcgatcggcg ggttctaccg gacatgcgta ctgactggca aggcgctggt tcggcggccc       120
     ttccattggc gtgaggcgat cgagcagggc tggttcatta ccagcgtctc gttgctgcca       180
     accctggcgg tgtcgattcc gttgaccgtg ttgatcatct tcacgctcaa tatcctgctg       240
     gccgagttcg gcgccgccga catctccggc gccggcgcgg cgctaggcgc ggtcacccag       300
     ctgggcccgc tgaccaccgt gttggtgatt gcgggcgctg gagccacagc gatctgcgcc       360
     gacctgggtg cccgcaccat ccgggaagag atcgatgcga tggaggtgct gggcatcgac       420
     cccatccacc ggctggtggt gcctcgggtc gttgccgcga ccatcgtcgc cgcactgctc       480
     aacggcgcgg tgataaccat tggcctggtt ggtggtttcg tcttcagtgt cttcatccaa       540
     cacgtctcgg ccggcgccta cgtgggcacg ctcaccttgg tcaccggtct acccgaggtg       600
     atcatctcgg tggtcaagtc ggcgacgttc ggcctgatcg ctggcctagt cggctgttac       660
     cgcgggctga ccacgaaagg cggccccaag ggagttggaa ccgccgtcaa cgaaaccctg       720
     gtgctgtgcg tgatcgcgct gttcgcgacc aatgtggtgt tgaccacgat cggcgtgcgg       780
     ttcgggacgg gacactag                                                     798
//

If you have problems or comments...

PBIL Back to PBIL home page