(data stored in ACNUC7421 zone)

EMBL: CP001658.PE608

CP001658.PE608       Location/Qualifiers
FT   CDS_pept        687073..688287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00596"
FT                   /product="MCE-family protein mce2A"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00596"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23629"
FT                   /protein_id="ACT23629.1"
FT                   /translation="MPTLVTRKNRRAWLYVEGVVLLLVGALVLVLVYKQFRGEFTPKTE
FT                   LTMVASRAGLVMEAGSKVTYNGVEIGRVGSISEIERDGRPAAKLVLDVNPRYISLIPVN
FT                   VVADIEAATLFGNKYVALSAPKIPQQQRISSHDVIDVGSVTTEFNTLFETITSIAEKVD
FT                   PIELNATLSAVAQALDGLGGKFGESIVNGNQILAQLNPRLPQLGYDVRRLADLGEVYVD
FT                   ASPDLWSFLQNALTTARTLTSQQRDLDAALLAATGAGNTGEDVFARGGPYLARAAADLV
FT                   PTATLLDTYSPELFCMIRNFHDAAPKVADAVGGNGYSLAAAGTILGAPNPYVYPDNLPR
FT                   VNAHGGPGGRPGCWQTITRELWPAPYLVMDTGASLAPYNHVELGQPMFTEYVWGRQYGE
FT                   NTINP"
     gtgccaacgc tggtgacgag gaagaaccga cgtgcgtggc tgtatgtgga gggtgttgtc        60
     ctgctgttgg tgggcgcgtt ggtgctcgta ttggtgtaca agcagtttcg tggggaattc       120
     acgccgaaga ccgagctgac tatggtcgcc tcccgggctg ggctggttat ggaagctgga       180
     tccaaagtca cctacaacgg ggtggagatc ggccgggtgg gcagcatttc ggagattgag       240
     cgtgacggcc ggccggcggc gaagctggtt ttggacgtga atcctcgcta catcagcctg       300
     attccggtca atgtggtggc cgatatcgag gcggccaccc tgttcggcaa caagtatgtt       360
     gcgctgtccg cgccgaaaat tcctcaacag cagcggattt cctcacatga cgtgattgat       420
     gtggggtcgg tgaccaccga attcaacacg ttgttcgaga cgatcacctc gatcgccgag       480
     aaggtggatc cgatcgagct gaacgcgacg ctgtccgcgg tagcacaggc gctggatggg       540
     ctgggcggca agttcggtga gtcgatcgtt aatggcaatc agattctggc gcaattaaat       600
     ccgcggctgc cgcagctcgg ctatgatgtt cggcggttgg cggatctcgg tgaggtctat       660
     gtcgatgctt cgccggatct gtggtccttt ctgcagaacg cactgaccac tgcgcgcaca       720
     ttgaccagcc aacagcgcga tctggatgcc gcgttgttgg cggctacggg tgcgggcaac       780
     accggtgaag acgtttttgc tcgaggcggg ccgtatcttg cgcgcgcagc cgccgatctg       840
     gtgcccaccg ctacgctgct ggacacctac agtcccgaac tgttctgcat gatccgcaac       900
     tttcacgacg ctgcgcccaa agtcgcggac gcggtgggcg gcaacggcta ttcgctagcg       960
     gccgccggaa cgattttggg agcacccaat ccctatgtct atccggacaa tctgccgcgg      1020
     gtgaatgccc acggtggacc cgggggccga ccgggctgct ggcagacgat cacccgggag      1080
     ctgtggccgg caccctatct ggtgatggac accggtgcca gcctcgcacc gtacaaccac      1140
     gtcgagctcg gccaaccgat gttcactgaa tacgtatggg gacgccaata cggagagaac      1200
     acgatcaacc catga                                                       1215
//

If you have problems or comments...

PBIL Back to PBIL home page