(data stored in ACNUC7421 zone)

EMBL: CP001658.PE609

CP001658.PE609       Location/Qualifiers
FT   CDS_pept        688284..689111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00597"
FT                   /product="MCE-family protein mce2B"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00597"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23630"
FT                   /protein_id="ACT23630.1"
FT                   /translation="MKTTGTTIKLGIVWLVLSVFTVMIIVVFGQVRFHHTTGYSAVFTH
FT                   VSGLRAGQFVRAAGVEVGKVAKVTLIDGDKQVLVDFTVDRSLSLDQATTASIRYLNLIG
FT                   DRYLELGRGHSGQRLAPGATIPLEHTHPALDLDALLGGFRPLFQTLDPDKVNSIASSII
FT                   TVFQGQGATINDILDQTASLTATLADRDHAIGEVVNNLNTVLATTVKHQTEFDRTVDKL
FT                   EVLITGLKNRADPLAAAAAHISSAAGTLADLLGRIVHCCTAASGTSRASSSRS"
     atgaaaacca caggcacaac tatcaaactc ggcatcgtct ggttggtgct gtcggtgttc        60
     accgtgatga tcatcgtggt gttcgggcag gtgcggttcc atcacaccac cgggtactcc       120
     gcggtgttca cccatgtcag cgggctgcgg gccgggcaat ttgtccgcgc tgcgggcgta       180
     gaggtcggca aggtcgccaa ggtaacgctg atcgacgggg acaagcaagt attggtggac       240
     ttcaccgtgg atcgctcgct gtcactggat caggcgacga ccgcctcgat ccgctacctc       300
     aacctgatcg gcgaccggta ccttgagctc ggccgcggtc acagcggtca gcggctggcg       360
     ccgggtgcca cgatcccgct cgagcacacc catccggcct tggatctcga cgctctgctc       420
     ggcgggtttc gcccactctt ccaaacgttg gacccagaca aggtcaacag catcgcctcc       480
     tcgatcatca ccgtgttcca agggcaaggc gccaccatca acgacatcct cgaccagacc       540
     gcctcgctga cggcaacgct ggccgaccgg gaccatgcga taggtgaggt cgtcaacaac       600
     ttgaacaccg tgctggccac caccgtcaag catcaaacgg aattcgaccg cacggtcgac       660
     aagctagagg tgctgatcac tggactgaag aacagggcgg acccgctggc cgcggcggcg       720
     gcacacatca gcagcgccgc gggaacccta gccgacctgc tggggcggat cgtccattgc       780
     tgcacagcag cttcgggcac ctcgagggca tccagcagcc gctcatag                    828
//

If you have problems or comments...

PBIL Back to PBIL home page