(data stored in ACNUC7421 zone)

EMBL: CP001658.PE610

CP001658.PE610       Location/Qualifiers
FT   CDS_pept        689060..689314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00598"
FT                   /product="MCE-family related protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00598"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23631"
FT                   /protein_id="ACT23631.1"
FT                   /translation="MLHSSFGHLEGIQQPLIDELAELDHVLGKLPDAYRIIGRAGGIYG
FT                   DFFNFYLCDISLKVNGLQPGGPVRTVKLFGQPTGRCTPQ"
     ttgctgcaca gcagcttcgg gcacctcgag ggcatccagc agccgctcat agacgagctg        60
     gcagaactcg accacgtgtt gggcaagctg ccggacgcct accggatcat cggccgcgcc       120
     ggcggcatat acggtgactt cttcaacttc tatctgtgtg acatctcact gaaagtcaac       180
     ggattacagc ctggaggtcc ggtacgcacc gtcaagttgt tcggccagcc gaccggcagg       240
     tgcacaccgc aatga                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page