(data stored in ACNUC7421 zone)

EMBL: CP001658.PE617

CP001658.PE617       Location/Qualifiers
FT   CDS_pept        complement(695920..697155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00605"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00605"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23638"
FT                   /protein_id="ACT23638.1"
FT                   /translation="MGVVERAIAPSVLAALADTPVVVVNGARQVGKTTLVARLDYPGSS
FT                   EVVSLDDVANRDAARDDPRAFVSRPVDTLVIDEAQLEPGLFRAIKAEVDRDRRPGRFLL
FT                   TGSARLLSAPDMADALVGRVEIIELWPFSQGERAGIADGFVDALFTAPRELIHGSDMRR
FT                   ADLVDRIATGGFPDIVARSPSRRRAWFDNYLTTATQSVIREISPIERLAEMPRVLRLCA
FT                   ARTGAELNVSALANDLSIPARTTAGYLALLEAAFLIHRVPAWSTNLSRKVIRRPKLVVS
FT                   DSGLACHLLGVTGATLDRPGRPLGPLLETFVANEIRKQLTWSTERPSLWHFRDRGGAEV
FT                   DLVLEHPDGRVCGIEVKATSTPRAEDLRGLRYLAERLDDRFQFGVLLTAAPEATPFGPT
FT                   LAALPVSTLWAG"
     atgggagtcg tcgaacgcgc gatcgcgccc tcggtgctgg ccgcgctcgc cgacaccccg        60
     gtcgtcgttg tcaacggcgc gcgtcaggtc ggcaaaacaa cactggtcgc gcgacttgac       120
     tatccgggat ccagcgaagt cgtctcgctt gacgacgtcg ccaaccgcga cgccgcccgc       180
     gacgatcccc gcgcattcgt atcccggccg gtggacacgc tcgtcatcga cgaagcccag       240
     ctcgagccgg ggctgtttcg ggcgatcaag gcagaggtcg accgggatcg caggccgggc       300
     aggttcctgc tcacgggttc agcgaggctg ctctcggctc ctgacatggc cgacgcgctc       360
     gtcgggcggg tcgaaatcat cgaactctgg ccgttctcgc aaggtgagcg ggccggaatc       420
     gcggacggtt tcgtcgatgc gctgttcacc gcaccacgcg agctgatcca cggctccgat       480
     atgcgccgcg ccgatctggt cgacaggatc gccaccggag gcttcccgga catcgtcgcc       540
     cgatcgccgt cgaggcgtcg cgcgtggttc gacaactatc tcacgacggc gacgcagtcg       600
     gtgatccgcg agatttcgcc gatcgagcgg cttgccgaaa tgccgcgtgt gcttcggctc       660
     tgcgccgcgc gtaccggcgc cgagctcaac gtgagcgcac tggcgaacga cctgtcgatc       720
     ccggctcgca ccaccgctgg ctatctggcc ctgctggaag cggcgttcct tatccaccgg       780
     gtgccggcct ggtcgaccaa cctgagccgc aaggtgattc gccgaccgaa actggtggtc       840
     tcggacagtg gcctggcgtg tcacctgctc ggcgttaccg gtgcgacgct ggatcgcccc       900
     ggccgtccac tcggcccgct actggagact ttcgtggcga acgagattcg caaacagctc       960
     acctggtcga ccgaacggcc gagtctgtgg cattttcgcg accgcggcgg cgccgaggtc      1020
     gatctggtgc tcgaacatcc cgatggtcgg gtctgcggca tcgaggtcaa ggcgaccagc      1080
     acgccgcgag ccgaggacct gcgtggccta cgttatctgg ccgagcggct cgatgatcga      1140
     tttcagttcg gcgtgctgct caccgccgcg ccggaagcca ccccgttcgg cccaacgctc      1200
     gcggcgttac ccgttagcac gctctgggcc ggctaa                                1236
//

If you have problems or comments...

PBIL Back to PBIL home page