(data stored in ACNUC7421 zone)

EMBL: CP001658.PE630

CP001658.PE630       Location/Qualifiers
FT   CDS_pept        704237..704464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_03994"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_03994"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23651"
FT                   /protein_id="ACT23651.1"
FT                   /translation="MELWAWTWERHGFRAFAETAAPQLIWREYRPGWTRYGDGSVAQVK
FT                   SIFDAPRGYLNAACRRRVVHWASGLLRRIL"
     gtggagttgt gggcgtggac ctgggaacgc cacgggttcc gggcgtttgc cgaaaccgct        60
     gcgccacagt tgatttggcg ggagtacaga cccggctgga cccgatacgg cgacggatct       120
     gtggcgcagg tcaaatcgat cttcgacgct ccgcgcggtt acctcaatgc ggcgtgtcgt       180
     cggcgtgttg tacattgggc atcgggactc ctgagaagga tcctgtag                    228
//

If you have problems or comments...

PBIL Back to PBIL home page