(data stored in ACNUC7421 zone)

EMBL: CP001658.PE635

CP001658.PE635       Location/Qualifiers
FT   CDS_pept        complement(707200..709767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00621"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00621"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23657"
FT                   /protein_id="ACT23657.1"
FT                   /translation="MAEAFDATQAVARILAEHGPLSEDDIARRLLDSGVADPDAVLRAL
FT                   RLETEWPARQLVDDRWVWLPTLLAGRVFTHRLGADEAVHDMLGVTPDLDPIITLCEHEE
FT                   YGRLADGSAARIVLAGYDEELLERRGIPDEAIDPGGALLLEPGTLATLGAAAGDLVGVR
FT                   LTAAGLVLERIGTAGADTSVGARLAELVDPDEPAFFPAAVWTACVDDPAAFTEPVAPLR
FT                   EILDQHGLTHEDDWLAPGGFNFDAWRFENRCELLAFRHDLDPNDAVALYTLIKLHETMS
FT                   LLLEATDPDELPRDVLATAAETATETGSDSLVDLLGDIGAALADPLLAELLVAETVGTD
FT                   SGGAAALGLLTEMLEPKVPRAARVAVRWLRAVALDRIGDVEAAERELLAAESMDTEWPL
FT                   PLLDLARIASDRGDAERGLALLRRAGTEPDHPLVRLLERHRAQPRRDLGRNEACWCGSG
FT                   RKYKKCHLGREALPLAERVDWLYAKASQHALSGDWTGLLAEVSYERFRYADSDDEDALA
FT                   AALADPLVLDAVLFEGGAFAEFLEVRGSLLPDDERLLAEQWLLVERSVFEVEHVQPGEG
FT                   VIVRDVRTGDTHEVHERAASRQLRAGQLICARPVPAGDTMVFFGGIEPVALHERAVLIE
FT                   LLDDEPDPVTLVAQLSRRFAPPTLVNTEGDSLAICEASVRVDDPAGIQGALDGVYDRVD
FT                   GEEPPRWIEHVTNDGMLRVRATLVLDGDTLRVETNSEPRMDRVLATLTRLDPAMTVLDD
FT                   DRRPLRNTREAAALAEQMPVTGAGAPDPDSPELAAALEEFIRDYETSWLDQPIPALDGH
FT                   TPRQAADDPTRRADLIKLLDTFPAGAGARGGMDADRLRTALGL"
     gtggccgaag cgttcgatgc gacccaagcc gtggcgagaa tcctggccga acatggccca        60
     ttgagcgagg acgacatcgc acgacgcctg ctggacagcg gcgtggccga cccggacgcc       120
     gtcctgcgcg cgcttcgcct tgaaacggaa tggccggcaa ggcagttggt cgacgatcgg       180
     tgggtgtggc tgccgacgct gctagccggg cgggtattca cccatcggct cggcgcggac       240
     gaggcggtcc acgacatgct cggcgtgacc ccggacctgg acccgatcat cacgctctgc       300
     gagcacgagg agtatggccg gctggccgac ggttcggcgg cgcggatcgt gctggccgga       360
     tacgacgagg agctgctcga acgacggggc atcccggacg aggccatcga ccccggcggg       420
     gcactgctgc tggagccggg cacgctggcg acgttggggg ccgccgcggg ggatctggtc       480
     ggtgtgcggc tgaccgccgc agggctggtg ctcgagcgga tcggcacagc cggtgcggac       540
     acctccgtcg gcgcccggct ggccgagctg gtcgaccccg acgagcccgc gttcttcccc       600
     gcggcggtct ggacggcgtg cgtcgacgac ccggcggcat ttaccgagcc agtggcaccg       660
     ctgcgcgaga tcctcgacca gcacggcctc acgcacgaag acgactggct agcacctggc       720
     ggattcaatt tcgacgcttg gcgtttcgag aaccgatgcg aactgctggc ctttcgccac       780
     gacctcgacc ccaacgacgc ggtcgcgctg tacacgctga tcaaactgca cgagacgatg       840
     tcgctgctgc tcgaagcaac cgacccggac gagttgccgc gggatgtgct cgccacagcc       900
     gccgagaccg cgacggaaac cggctccgac tcgttggtcg atctgctcgg cgacattggg       960
     gcggcgctgg ccgacccgct gctggccgag ctgctggtgg cagagacggt gggcaccgac      1020
     tccggcgggg cggccgcgct gggcctgctc accgagatgc tggagcccaa ggtgccgcgc      1080
     gcggcgcggg tggcggtgcg ctggctgcgc gcggtcgcgc tggaccggat cggtgatgtc      1140
     gaggcggccg aacgtgagct gctggcggcc gagtcgatgg acaccgagtg gccgctgccg      1200
     ttgctcgacc tggcccgcat cgcctccgat cgcggcgacg ccgagcgcgg gttggcactg      1260
     ctgcgccgcg ccggcaccga acccgaccac ccgctggtgc ggctcctgga gcggcaccga      1320
     gcccagccgc gccgcgacct gggccgcaac gaggcgtgct ggtgcgggtc gggccgcaag      1380
     tacaagaaat gccatctcgg ccgtgaggcg ctgccgctgg ccgagcgggt ggactggctg      1440
     tatgccaagg catcccagca cgcactgtcg ggcgactgga ccggcctgct ggccgaagtc      1500
     agctatgagc gcttccggta tgccgactct gacgatgagg acgcgctggc cgcggcgctg      1560
     gccgatccgc tggtgctgga cgcggtgttg ttcgagggcg gcgcgttcgc ggagttcctc      1620
     gaagtgcgcg gttcgctgct acccgacgac gagcggctgc ttgccgagca atggctgctc      1680
     gtggagcggt cggtgttcga ggtcgagcac gtgcaacctg gcgagggcgt gatcgtgcgc      1740
     gacgtacgca ccggcgacac ccatgaggtg catgagcggg cggccagccg ccagctgcga      1800
     gccgggcagc tgatctgcgc gcgcccggtg cccgccgggg acaccatggt gttcttcggc      1860
     gggatcgagc cggtcgcgct gcacgagcgt gccgtgctga tcgagctgct cgatgacgag      1920
     cccgacccgg tgacactggt ggcccagctg agccgccggt tcgcgccgcc gacactggtc      1980
     aacaccgagg gcgactcgct ggcaatctgc gaggccagcg tgcgagtcga cgatccggcc      2040
     gggatccagg gcgcgctcga cggggtctac gaccgggttg acggcgagga gccgccgcgg      2100
     tggatcgaac acgtcaccaa cgacggcatg ctgcgggtcc gggccacgct ggtcctcgac      2160
     ggtgacacgc tgcgggtgga aaccaacagc gaaccgcgga tggatcgcgt gctggccacg      2220
     ctgacccgcc tcgacccggc gatgacggtg ctcgacgacg accgccgtcc gctgcgcaac      2280
     acccgcgagg ccgccgcgct ggccgagcag atgccagtta ccggcgcggg cgcgcccgac      2340
     cccgacagcc ccgagctggc cgccgcgctc gaggaattca tccgcgacta cgagaccagc      2400
     tggctcgatc aacccatccc cgcgctggac gggcacacgc cgcggcaggc cgccgacgac      2460
     cccacccgcc gcgccgacct gatcaagctc ctggacacgt ttcccgccgg cgcgggcgcc      2520
     cgtggcggga tggacgccga ccggctgcgc accgctttgg gcttgtag                   2568
//

If you have problems or comments...

PBIL Back to PBIL home page