(data stored in ACNUC7421 zone)

EMBL: CP001658.PE638

CP001658.PE638       Location/Qualifiers
FT   CDS_pept        complement(710836..711102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00624"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00624"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23660"
FT                   /protein_id="ACT23660.1"
FT                   /translation="MRIPGNRQCLLVQVLRQVDGSAHRLILTSLHRDARADAHRYSNGT
FT                   DHAGRAADEPAETAHEPCWVAARGLASQASRAMSATYRPSSFI"
     gtgcgtatcc cgggcaatcg ccagtgcctg cttgtgcagg tcttgcggca ggtcgatggt        60
     agtgcgcacc gcctcatcct aacatcgctg catcgtgatg cgcgcgccga cgctcaccgg       120
     tattccaacg ggactgatca tgctggccgt gcggcagacg agccggccga gacagcgcac       180
     gagccgtgtt gggtggcggc ccgagggctg gcctcacagg ctagccgcgc gatgagtgcg       240
     acctacaggc cctcttcgtt catctaa                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page