(data stored in ACNUC7421 zone)

EMBL: CP001658.PE656

CP001658.PE656       Location/Qualifiers
FT   CDS_pept        complement(729579..730439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00642"
FT                   /product="hypothetical exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00642"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23677"
FT                   /protein_id="ACT23677.1"
FT                   /translation="MSLWYKRMVDSMGWVLSSWHEVTGVDSGTWLAWAAWAALGLGVVA
FT                   LVVTKRQIQRNRRLAAEQTRPYVAMFMEPHVADWHVIELVVRNFGRTAAYDVRFSFPNP
FT                   PTVAQYENAANGYADVVELRLPQELPMLAPGQEWRMVWDSALDRAEIGRGIESRFPGTV
FT                   TYYDRPEQPRRWRFWRRGRRPLETKVVLDWDALPPVARIELMTTHDLAKREKQKLELLR
FT                   SLLTYFHYASKETRPDVFRSEIDRINRAAAETQDRWRARQVEVPTEVSQRSEGQGPQPT
FT                   RIPAG"
     atgtcactgt ggtataagcg gatggtggat tccatggggt gggtcctgag cagctggcat        60
     gaggtcaccg gcgtcgactc cggcacctgg ttggcgtggg ccgcgtgggc ggcgcttggg       120
     ctcggtgtgg tcgccctggt ggtgaccaag cggcaaatcc aacgcaatcg tcgactggct       180
     gcggagcaga ctcggcccta cgtggccatg tttatggagc cccacgtcgc ggactggcac       240
     gtgatcgagc tggtagtccg caacttcggt cgcacagccg cctacgacgt ccggttctcg       300
     ttccccaacc caccaaccgt ggcccaatac gagaatgccg ccaacggcta cgccgatgtc       360
     gtggaacttc ggctgcccca agagttgccg atgctggctc ccggtcagga gtggcggatg       420
     gtgtgggatt cagcgctcga tcgcgccgag atcgggcggg gcatcgagtc tcgcttcccg       480
     ggcacggtga cctactacga ccgacccgag cagccgcgcc gatggcggtt ctggcggcgc       540
     ggacggcgtc cgttggagac caaagtggtg ctggactggg atgccctgcc gcccgttgcg       600
     cgcatcgagc tgatgaccac ccacgacctg gcgaagcggg aaaagcagaa gctggagctg       660
     ttacgtagtc tgttgacgta ttttcactac gcgagcaagg agacgcgtcc cgacgtgttc       720
     cgcagcgaga tcgaccggat caaccgcgcc gcggccgaaa cccaggacag gtggcgcgct       780
     cggcaggtcg aggtgcccac cgaggtcagc cagcgctcgg aggggcaagg gccacagccc       840
     acgcggatac cggcaggcta a                                                 861
//

If you have problems or comments...

PBIL Back to PBIL home page