(data stored in ACNUC7421 zone)

EMBL: CP001658.PE659

CP001658.PE659       Location/Qualifiers
FT   CDS_pept        731964..732131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00645"
FT                   /product="50S ribosomal protein L33 rpmG2"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00645"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23680"
FT                   /protein_id="ACT23680.1"
FT                   /translation="MASSTDVRPKITLACEVCKHRNYITKKNRRNDPDRLELKKFCPNC
FT                   GKHQAHRETR"
     atggcttcca gtaccgacgt gcggccgaag atcactttgg catgcgaggt gtgcaagcac        60
     cgtaactaca tcaccaaaaa gaaccgccgc aacgacccgg accggctgga gctgaagaag       120
     ttctgcccga attgcggcaa acaccaggcg caccgcgaga cgcggtaa                    168
//

If you have problems or comments...

PBIL Back to PBIL home page