(data stored in ACNUC7421 zone)

EMBL: CP001658.PE660

CP001658.PE660       Location/Qualifiers
FT   CDS_pept        732182..732658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00646"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00646"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23681"
FT                   /protein_id="ACT23681.1"
FT                   /translation="MALSADIVGMHYRYPDHYEVEREKIREYAVAVQNDDAWYFEEDGA
FT                   AELGYKGLLAPLTFICVFGYKAQAAFFKHANIATAEAQIVQVDQVLKFEKPIVAGDKLY
FT                   CDVYVDSVREAHGTQIIVTKNIVTNEEGDLVQETYTTLAGRAGEDGEGFSDGAA"
     gtggcgttga gcgcagacat cgttgggatg cattaccggt atcccgacca ctacgaggtg        60
     gagcgggaga agattcgcga gtacgccgtc gccgttcaaa acgacgacgc gtggtatttc       120
     gaggaggacg gcgccgccga actcgggtat aagggcttgc tggctccgtt gacgtttatc       180
     tgtgtgttcg gctacaaggc ccaggcggcg ttcttcaagc atgcgaacat cgcgaccgcg       240
     gaggcgcaga tcgtccaggt agaccaagtg ctgaaattcg agaaaccgat cgtggcgggc       300
     gacaagctgt actgcgacgt ctatgtggat tcggtgcgtg aggcgcacgg cacccagatc       360
     atcgtgacca agaacatcgt caccaacgag gaaggtgacc tcgtgcagga gacctatacg       420
     accctggcgg gccgtgccgg cgaggatgga gagggatttt ctgatggcgc tgcgtga          477
//

If you have problems or comments...

PBIL Back to PBIL home page