(data stored in ACNUC7421 zone)

EMBL: CP001658.PE664

CP001658.PE664       Location/Qualifiers
FT   CDS_pept        734506..735222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00650"
FT                   /product="transcription antitermination protein nusG"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00650"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23685"
FT                   /protein_id="ACT23685.1"
FT                   /translation="MTTFDGDTSAGEAVDLTEANAFQDAAAPAEEVDPAAALKAELRSK
FT                   PGDWYVVHSYAGYENKVKANLETRVQNLDVGDYIFQVEVPTEEVTEIKNGQRKQVNRKV
FT                   LPGYILVRMDLTDDSWAAVRNTPGVTGFVGATSRPSALALDDVVKFLLPRGSTRKAAKG
FT                   AASTAAAAEAGGLERPVVEVDYEVGESVTVMDGPFATLPATISEVNAEQQKLKVLVSIF
FT                   GRETPVELTFGQVSKI"
     gtgactacct tcgacggtga cacgtccgcg ggtgaggcgg tcgatctaac agaggccaac        60
     gccttccagg atgcagcggc cccggctgaa gaggtcgatc cggccgccgc gctcaaagcg       120
     gagctgcgca gcaagcccgg cgactggtac gtcgttcact cctacgcagg gtacgagaac       180
     aaggtcaagg ccaacctgga aacccgggtg cagaaccttg atgtcggcga ctacatcttc       240
     caggtggagg tgcccaccga agaggtcacc gagatcaaaa acggccaacg caagcaggtc       300
     aaccgtaagg tgctgcccgg ctacattctg gtgcggatgg acttgaccga cgactcctgg       360
     gccgcggtgc gtaacacgcc gggggtcacg gggttcgttg gggcaacatc tcgcccgtca       420
     gcgctcgccc tcgacgacgt ggtgaagttt ctgcttccgc gggggtcgac gaggaaggct       480
     gccaagggtg cggccagcac ggctgccgcc gccgaggcgg gcgggctaga gcgtccggtc       540
     gtcgaggtcg actacgaggt gggcgaatcg gtaaccgtca tggacgggcc gtttgccaca       600
     ttgccggcca cgatcagcga ggtcaacgcc gaacagcaga aactcaaggt gctggtctcc       660
     atcttcggcc gcgaaacacc ggtggagctg acctttggcc aagtctccaa gatctag          717
//

If you have problems or comments...

PBIL Back to PBIL home page