(data stored in ACNUC7421 zone)

EMBL: CP001658.PE666

CP001658.PE666       Location/Qualifiers
FT   CDS_pept        735769..736476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00652"
FT                   /product="50S ribosomal protein L1 rplA"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00652"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23687"
FT                   /protein_id="ACT23687.1"
FT                   /translation="MSKTSKAYRAAAAKVDRTNLYTPLQAAKLAKETSSTKQDATVEVA
FT                   IRLGVDPRKADQMVRGTVNLPHGTGKTARVAVFAVGEKADAAVAAGADVVGSDDLIERI
FT                   QGGWLEFDAAIATPDQMAKVGRIARVLGPRGLMPNPKTGTVTADVAKAVADIKGGKINF
FT                   RVDKQANLHFVIGKASFDEKLLAENYGAAIDEVLRLKPSSSKGRYLKKITVSTTTGPGI
FT                   PVDPSITRNFAGE"
     atgagcaaga ccagcaaggc atatcgcgcc gccgccgcga aggtggaccg caccaacctc        60
     tacaccccgc tgcaggcggc caagcttgcc aaagagacct cgtcgaccaa gcaggacgcg       120
     accgtcgagg tggcgatccg gcttggcgtc gacccgcgta aggcagacca gatggttcgc       180
     ggcacggtca acctgccaca cggcactggt aagactgccc gcgtcgcggt attcgcggtt       240
     ggtgaaaagg ccgatgctgc cgttgccgcg ggggcggatg ttgtcgggag tgacgatctg       300
     atcgagagga ttcagggcgg ctggctggaa ttcgatgccg cgatcgcgac accggatcag       360
     atggccaaag tcggtcgcat cgctcgggtg ctgggtccgc gcggcctgat gcccaacccg       420
     aaaaccggca ccgtcaccgc cgacgtcgcc aaggccgtcg cggacatcaa gggcggcaag       480
     atcaacttcc gggttgacaa gcaggccaac ctgcacttcg tcatcgggaa agcgtcgttc       540
     gacgagaagt tgttggcgga gaactacggc gcggcgatcg acgaggtgct gcggctcaag       600
     ccgtcctcgt cgaagggccg ctacctgaag aagatcaccg tgtcgacgac gacgggcccg       660
     ggcattccgg tcgacccatc catcacccgc aacttcgcgg gggagtag                    708
//

If you have problems or comments...

PBIL Back to PBIL home page