(data stored in ACNUC7421 zone)

EMBL: CP001658.PE676

CP001658.PE676       Location/Qualifiers
FT   CDS_pept        749061..749597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00662"
FT                   /product="50S ribosomal protein L10 rplJ"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00662"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23697"
FT                   /protein_id="ACT23697.1"
FT                   /translation="MARADKATAVADIAAQFKESTATLITEYRGLTVANLAELRRSLTG
FT                   SATYAVAKNTLIKRAASEAGIEGLDELFVGPTAIAFVTGEPVDAAKAIKTFAKEHKALV
FT                   IKGGYMDGHPLTVAEVERIADLESREVLLAKLAGAMKGNLAKAAGLFNAPASQLARLAA
FT                   ALQEKKACPGPDSAE"
     atggccaggg ctgacaaggc caccgccgtc gcagacatcg cagcgcagtt caaggagtcg        60
     accgcgacgt tgatcaccga ataccgcggc ttgacggtgg ccaacctggc cgagctacgc       120
     aggtctctga cggggtcggc gacctacgcg gtggccaaaa acacactcat caagcgggcg       180
     gcctccgagg ccggcatcga gggcctcgac gaactgtttg tgggccccac cgcgatcgcg       240
     ttcgtcaccg gtgagccggt cgacgccgcc aaggccatca agaccttcgc caaggagcac       300
     aaggcgctgg tcatcaaggg cggctacatg gacggccacc cattgaccgt ggccgaagtc       360
     gagcgcatcg ccgacctgga gtcccgcgag gtgttactgg ccaagctggc cggtgcgatg       420
     aagggcaacc tggccaaggc ggccgggttg ttcaacgcgc cggcctcgca gctggcccgg       480
     ctcgcggccg ccctgcagga aaagaaggcc tgcccaggcc cagactcagc cgagtag          537
//

If you have problems or comments...

PBIL Back to PBIL home page