(data stored in ACNUC7421 zone)

EMBL: CP001658.PE677

CP001658.PE677       Location/Qualifiers
FT   CDS_pept        749634..750026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00663"
FT                   /product="50S ribosomal protein L7/L12 rplL"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00663"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23698"
FT                   /protein_id="ACT23698.1"
FT                   /translation="MAKLSTDELLDAFKEMTLLELSDFVKKFEETFEVTAAAPVAVAAA
FT                   GAAPAGAAVEAAEEQSEFDVILEAAGDKKIGVIKVVREIVSGLGLKEAKDLVDGAPKPL
FT                   LEKVAKEAADEAKAKLEAAGATVTVK"
     atggcaaagc tctccaccga cgaactgctg gacgcgttca aggaaatgac cctgttggag        60
     ctctccgact tcgtcaagaa gttcgaggag accttcgagg tcaccgccgc cgctccagtc       120
     gccgtcgccg ccgccggtgc cgccccggcc ggtgccgccg tcgaggctgc cgaggagcag       180
     tccgagttcg acgtgatcct tgaggccgcc ggcgacaaga agatcggcgt catcaaggtg       240
     gtccgggaga tcgtttccgg cctgggcctc aaggaggcca aggacctggt cgacggcgcg       300
     cccaagccgc tgctggagaa ggtcgccaag gaggccgccg acgaggccaa ggccaagctg       360
     gaggccgccg gcgccaccgt caccgtcaag tag                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page