(data stored in ACNUC7421 zone)

EMBL: CP001658.PE680

CP001658.PE680       Location/Qualifiers
FT   CDS_pept        752302..753381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00666"
FT                   /product="ribonucleotide-transport ATP-binding protein ABC
FT                   transporter mkl"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00666"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23701"
FT                   /protein_id="ACT23701.1"
FT                   /translation="MRYSDSYHTTGRWQPRASTEGFPMGVSIEVNGLTKSFGSSRIWED
FT                   VTLTIPAGEVSVLLGPSGTGKSVFLKSLIGLLRPERGSIIIDGTDIIECSAKELYEIRT
FT                   LFGVLFQDGALFGSMNLYDNTAFPLREHTKKKESEIRDIAMEKLALVGLGGDEKKFPGE
FT                   ISGGMRKRAGLARALVLDPQIILCDEPDSGLDPVRTAYLSQLIMDINAQIDATILIVTH
FT                   NINIARTVPDNMGMLFRKHLVMFGPREVLLTSDEPVVRQFLNGRRIGPIGMSEGKDEAT
FT                   MAEEQALLDAGHHAGGVEEIEGVPPQISATPGMPERKAVARRQARVREMLHTLPKKAQA
FT                   AILDDLEGTHKYAVHEIGQ"
     gtgcgataca gtgactcata ccacacaacg ggccggtggc agccacgagc gtcgacagaa        60
     gggtttccca tgggcgtcag catcgaggtc aacggactaa cgaagtcctt cgggtcctcg       120
     aggatctggg aagatgtcac gctaacgatc cccgccgggg aggtcagcgt gctgctgggc       180
     ccatcgggta ccggcaaatc ggtgtttctg aaatctctga tcggcctcct gcggccggag       240
     cgcggctcga tcatcatcga cggcaccgac atcatcgaat gctcggccaa ggagctttac       300
     gagatccgca cattgttcgg cgtgctgttt caggacggtg ccctgttcgg gtcgatgaac       360
     ctctacgaca acaccgcgtt ccccctgcgt gagcacacca agaaaaagga aagcgagatc       420
     cgtgacatcg ccatggagaa gctggcccta gtcggcctgg gtggggacga gaagaagttc       480
     cccggcgaga tctccggcgg gatgcgtaag cgtgccggcc tagcgcgtgc cctggtcctt       540
     gacccgcaga tcattctctg cgacgagccc gactcgggtc tggacccggt tcgtaccgcc       600
     tacctgagcc agctgatcat ggacatcaac gcccagatcg acgccaccat cctgatcgtg       660
     acgcacaaca tcaacatcgc ccgcaccgtg ccggacaaca tgggcatgtt gttccgcaag       720
     catttggtga tgttcgggcc gcgggaggtg ctactcacca gcgacgagcc ggtggtgcgg       780
     cagttcctca acggccggcg catcggcccg atcggcatgt ccgaggggaa ggacgaggcc       840
     accatggccg aagagcaggc cctgctcgat gccggccacc acgcgggcgg tgtcgaggaa       900
     atcgagggcg tgccgccgca gatcagcgcg acaccgggca tgccggagcg caaagcggtc       960
     gcccggcgtc aggctcgggt tcgcgagatg ttgcacacgc tgcccaaaaa ggcccaggcg      1020
     gcgatcctcg acgatctcga gggcacgcac aagtacgcgg tgcacgaaat cggccagtaa      1080
//

If you have problems or comments...

PBIL Back to PBIL home page