(data stored in ACNUC7421 zone)

EMBL: CP001658.PE683

CP001658.PE683       Location/Qualifiers
FT   CDS_pept        complement(754478..755194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00669"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00669"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23704"
FT                   /protein_id="ACT23704.1"
FT                   /translation="MEAGRADTVAPSHRWGLGAFLVVELVFLVASTSLAVVLTGHGPVS
FT                   AGVLALALAAPTVVAAGLAILITRLHGNGPRTDLRLRWSWRGLRLGLMFGFGGMLVTIP
FT                   ASLVYTAIVGPEANSAVVRIFGGVRASWPWALVVFLVVVFVAPLCEEIIYRGLLWGAVD
FT                   RRWGRWAALVVTTVVFALAHLEFARAPLLVVVAIPIALARFYSGGLLASIVTHQVTNLL
FT                   PGIVLLLGLTGAISLP"
     gtggaagcgg gccgtgccga taccgtagcc cccagtcacc gctggggact tggggccttc        60
     ttggtcgtcg agctggtatt cctggtcgcc tcgacttcgt tagcggttgt ccttaccggt       120
     cacggcccgg tgtctgccgg ggtgctggcc cttgcgctag ccgcccccac ggtggtcgcc       180
     gccgggctgg ccatcctcat caccaggctc cacggcaacg gcccccgcac cgacttgcgg       240
     ctgcgctggt cgtggcgcgg actgcggctc gggttgatgt tcggtttcgg cggaatgctg       300
     gtcacgattc cggcgtcgct ggtctacacc gctatcgttg ggccagaagc gaattccgct       360
     gtagtaagga ttttcggtgg cgttcgggcg tcctggccgt gggcgctggt cgtctttctg       420
     gtcgtggtgt tcgtcgcgcc actgtgcgaa gagatcatct accgcgggct gctctggggt       480
     gctgtggatc ggcgctgggg tcggtgggcg gcgctggtgg ttaccaccgt ggtcttcgca       540
     ttggcccatc tcgagttcgc ccgagctcca ctgctggtgg tggtggccat cccgatcgcg       600
     ctggcacggt tctattccgg cggtctactg gccagcatcg tcacgcacca agtgaccaac       660
     ctattgcccg ggatcgtatt gctgcttggt ctgactggcg ccatatcgtt gccctga          717
//

If you have problems or comments...

PBIL Back to PBIL home page