(data stored in ACNUC7421 zone)

EMBL: CP001658.PE691

CP001658.PE691       Location/Qualifiers
FT   CDS_pept        759921..760094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00677"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00677"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23712"
FT                   /protein_id="ACT23712.1"
FT                   /translation="MTPRTDEGAAAPCLMPDVTMPVKRGDARGALGVGPALFVVSVSSS
FT                   LVRARSCRCTAD"
     gtgacaccga ggactgatga aggtgccgct gcaccctgcc tgatgcctga cgtcacgatg        60
     cccgtgaagc gtggtgatgc ccggggagct ttgggtgtgg gtccagcttt gttcgtggtg       120
     agcgtgagca gctcgctggt gagggccagg agctgtcgtt gcacggcgga ttga             174
//

If you have problems or comments...

PBIL Back to PBIL home page