(data stored in ACNUC7421 zone)

EMBL: CP001658.PE693

CP001658.PE693       Location/Qualifiers
FT   CDS_pept        760574..764110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00679"
FT                   /product="DNA-directed RNA polymerase subunit beta rpoB"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00679"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23714"
FT                   /protein_id="ACT23714.1"
FT                   /translation="MLEGCILADSRQSKTAASPSPSRPQSSSNNSVPGAPNRVSFAKLR
FT                   EPLEVPGLLDVQTDSFEWLIGSPRWRESAAERGDVNPVGGLEEVLYELSPIEDFSGSMS
FT                   LSFSDPRFDDVKAPVDECKDKDMTYAAPLFVTAEFINNNTGEIKSQTVFMGDFPMMTEK
FT                   GTFIINGTERVVVSQLVRSPGVYFDETIDKSTDKTLHSVKVIPSRGAWLEFDVDKRDTV
FT                   GVRIDRKRRQPVTVLLKALGWTSEQIVERFGFSEIMRSTLEKDNTVGTDEALLDIYRKL
FT                   RPGEPPTKESAQTLLENLFFKEKRYDLARVGRYKVNKKLGLHVGEPITSSTLTEEDVVA
FT                   TIEYLVRLHEGQTTMTVPGGVEVPVETDDIDHFGNRRLRTVGELIQNQIRVGMSRMERV
FT                   VRERMTTQDVEAITPQTLINIRPVVAAIKEFFGTSQLSQFMYQNNPLSGLTHKRRLSAL
FT                   GPGGLSRERAGLEVRDVHPSHYGRMCPIETPEGPSIGLIGSLSVYARVNPFGFIETPYR
FT                   KVVDGVVSDEIVYLTADEEDRHVVAQANSPIDADGRFVEPRVLVRRKAGEVEYVPSSEV
FT                   DYMDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLVRSEAPLVGTGMELRAA
FT                   IDAGDVVVAEESGVIEEVSADYITVMHDNGTRRTYRMRKFARSNHGTCANQCPIVDAGD
FT                   RVEAGQVIADGPCTDDGEMALGKNLLVAIMPWEGHNYEDAIILSNRLVEEDVLTSIHIE
FT                   EHEIDARDTKLGAEEITRDIPNISDEVLADLDERGIVRIGAEVRDGDILVGKVTPKGET
FT                   ELTPEERLLRAIFGEKAREVRDTSLKVPHGESGKVIGIRVFSREDEDELPAGVNELVRV
FT                   YVAQKRKISDGDKLAGRHGNKGVIGKILPVEDMPFLADGTPVDIILNTHGVPRRMNIGQ
FT                   ILETHLGWCAHSGWKVDAAKGVPDWAARLPDELLEAQPNAIVSTPVFDGAQEAELQGLL
FT                   SCTLPNRDGDVLVDADGKAMLFDGRSGEPFPYPVTVGYMYIMKLHHLVDDKIHARSTGP
FT                   YSMITQQPLGGKAQFGGQRFGEMECWAMQAYGAAYTLQELLTIKSDDTVGRVKVYEAIV
FT                   KGENIPEPGIPESFKVLLKELQSLCLNVEVLSSDGAAIELREGEDEDLERAAANLGINL
FT                   SRNESASVEDLA"
     gtgctggaag gatgcatctt ggcagattcc cgccagagca aaacagccgc tagtcctagt        60
     ccgagtcgcc cgcaaagttc ctcgaataac tccgtacccg gagcgccaaa ccgggtctcc       120
     ttcgctaagc tgcgcgaacc acttgaggtt ccgggactcc ttgacgtcca gaccgattcg       180
     ttcgagtggc tgatcggttc gccgcgctgg cgcgaatccg ccgccgagcg gggtgatgtc       240
     aacccagtgg gtggcctgga agaggtgctc tacgagctgt ctccgatcga ggacttctcc       300
     gggtcgatgt cgttgtcgtt ctctgaccct cgtttcgacg atgtcaaggc acccgtcgac       360
     gagtgcaaag acaaggacat gacgtacgcg gctccactgt tcgtcaccgc cgagttcatc       420
     aacaacaaca ccggtgagat caagagtcag acggtgttca tgggtgactt cccgatgatg       480
     accgagaagg gcacgttcat catcaacggg accgagcgtg tggtggtcag ccagctggtg       540
     cggtcgcccg gggtgtactt cgacgagacc attgacaagt ccaccgacaa gacgctgcac       600
     agcgtcaagg tgatcccgag ccgcggcgcg tggctcgagt ttgacgtcga caagcgcgac       660
     accgtcggcg tgcgcatcga ccgcaaacgc cggcaaccgg tcaccgtgct gctcaaggcg       720
     ctgggctgga ccagcgagca gattgtcgag cggttcgggt tctccgagat catgcgatcg       780
     acgctggaga aggacaacac cgtcggcacc gacgaggcgc tgttggacat ctaccgcaag       840
     ctgcgtccgg gcgagccccc gaccaaagag tcagcgcaga cgctgttgga aaacttgttc       900
     ttcaaggaga agcgctacga cctggcccgc gtcggtcgct ataaggtcaa caagaagctc       960
     gggctgcatg tcggcgagcc catcacgtcg tcgacgctga ccgaagaaga cgtcgtggcc      1020
     accatcgaat atctggtccg cttgcacgag ggtcagacca cgatgaccgt tccgggcggc      1080
     gtcgaggtgc cggtggaaac cgacgacatc gaccacttcg gcaaccgccg cctgcgtacg      1140
     gtcggcgagc tgatccaaaa ccagatccgg gtcggcatgt cgcggatgga gcgggtggtc      1200
     cgggagcgga tgaccaccca ggacgtggag gcgatcacac cgcagacgtt gatcaacatc      1260
     cggccggtgg tcgccgcgat caaggagttc ttcggcacca gccagctgag ccaattcatg      1320
     taccagaaca acccgctgtc ggggttgacc cacaagcgcc gactgtcggc gctggggccc      1380
     ggcggtctgt cacgtgagcg tgccgggctg gaggtccgcg acgtgcaccc gtcgcactac      1440
     ggccggatgt gcccgatcga aacccctgag gggcccagca tcggtctgat cggctcgctg      1500
     tcggtgtacg cgcgggtcaa cccgttcggg ttcatcgaaa cgccgtaccg caaggtggtc      1560
     gacggcgtgg ttagcgacga gatcgtgtac ctgaccgccg acgaggagga ccgccacgtg      1620
     gtggcacagg ccaattcgcc gatcgatgcg gacggtcgct tcgtcgagcc gcgcgtgctg      1680
     gtccgccgca aggcgggcga ggtggagtac gtgccctcgt ctgaggtgga ctacatggac      1740
     gtctcgcccc gccagatggt gtcggtggcc accgcgatga ttcccttcct ggagcacgac      1800
     gacgccaacc gtgccctcat gggggcaaac atgcagcgcc aggcggtgcc gctggtccgt      1860
     agcgaggccc cgctggtggg caccgggatg gagctgcgcg cggcgatcga cgccggcgac      1920
     gtcgtcgtcg ccgaagaaag cggcgtcatc gaggaggtgt cggccgacta catcactgtg      1980
     atgcacgaca acggcacccg gcgtacctac cggatgcgca agtttgcccg gtccaaccac      2040
     ggcacttgcg ccaaccagtg ccccatcgtg gacgcgggcg accgagtcga ggccggtcag      2100
     gtgatcgccg acggtccctg tactgacgac ggcgagatgg cgctgggcaa gaacctgctg      2160
     gtggccatca tgccgtggga gggccacaac tacgaggacg cgatcatcct gtccaaccgc      2220
     ctggtcgaag aggacgtgct cacctcgatc cacatcgagg agcatgagat cgatgctcgc      2280
     gacaccaagc tgggtgcgga ggagatcacc cgcgacatcc cgaacatctc cgacgaggtg      2340
     ctcgccgacc tggatgagcg gggcatcgtg cgcatcggtg ccgaggttcg cgacggggac      2400
     atcctggtcg gcaaggtcac cccgaagggt gagaccgagc tgacgccgga ggagcggctg      2460
     ctgcgtgcca tcttcggtga gaaggcccgc gaggtgcgcg acacttcgct gaaggtgccg      2520
     cacggcgaat ccggcaaggt gatcggcatt cgggtgtttt cccgcgagga cgaggacgag      2580
     ttgccggccg gtgtcaacga gctggtgcgt gtgtatgtgg ctcagaaacg caagatctcc      2640
     gacggtgaca agctggccgg ccggcacggc aacaagggcg tgatcggcaa gatcctgccg      2700
     gttgaggaca tgccgttcct tgccgacggc accccggtgg acattatttt gaacacccac      2760
     ggcgtgccgc gacggatgaa catcggccag attttggaga cccacctggg ttggtgtgcc      2820
     cacagcggct ggaaggtcga cgccgccaag ggggttccgg actgggccgc caggctgccc      2880
     gacgaactgc tcgaggcgca gccgaacgcc attgtgtcga cgccggtgtt cgacggcgcc      2940
     caggaggccg agctgcaggg cctgttgtcg tgcacgctgc ccaaccgcga cggtgacgtg      3000
     ctggtcgacg ccgacggcaa ggccatgctc ttcgacgggc gcagcggcga gccgttcccg      3060
     tacccggtca cggttggcta catgtacatc atgaagctgc accacctggt ggacgacaag      3120
     atccacgccc gctccaccgg gccgtactcg atgatcaccc agcagccgct gggcggtaag      3180
     gcgcagttcg gtggccagcg gttcggggag atggagtgct gggccatgca ggcctacggt      3240
     gctgcctaca ccctgcagga gctgttgacc atcaagtccg atgacaccgt cggccgcgtc      3300
     aaggtgtacg aggcgatcgt caagggtgag aacatcccgg agccgggcat ccccgagtcg      3360
     ttcaaggtgc tgctcaaaga actgcagtcg ctgtgcctca acgtcgaggt gctatcgagt      3420
     gacggtgcgg cgatcgaact gcgcgaaggt gaggacgagg acctggagcg ggccgcggcc      3480
     aacctgggaa tcaatctgtc ccgcaacgaa tccgcaagtg tcgaggatct tgcgtaa         3537
//

If you have problems or comments...

PBIL Back to PBIL home page