(data stored in ACNUC7421 zone)

EMBL: CP001658.PE695

CP001658.PE695       Location/Qualifiers
FT   CDS_pept        complement(768102..768422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00681"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00681"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23716"
FT                   /protein_id="ACT23716.1"
FT                   /translation="MERSGLLECVAGLDEQPFGEFTADKLNPDRGSSRRVPRRQADGGI
FT                   ATHVERGGGQRQSGGQAGVVPQRMHGFPASAMQDRLIHHGEQTQNRIAQAFRVRFCVCS
FT                   PT"
     atggaacgca gtggcctgct ggaatgcgtg gccggcttgg acgagcaacc gttcggcgaa        60
     ttcacggccg ataaactaaa ccccgaccgg ggttcctcac gacgtgtccc ccgcaggcag       120
     gcagatggcg ggattgccac tcatgttgaa cggggcggcg ggcagcgcca atctggcggc       180
     caggccggcg tcgtgcccca acgcatgcat gggtttcccg catcggcgat gcaagaccgg       240
     ctcatccacc acggcgagca gacgcagaat cgcatcgcgc aggcatttcg cgtgcgattc       300
     tgcgtctgct cgcccaccta g                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page