(data stored in ACNUC7421 zone)

EMBL: CP001658.PE7

CP001658.PE7         Location/Qualifiers
FT   CDS_pept        10016..10930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00007"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00007"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23028"
FT                   /protein_id="ACT23028.1"
FT                   /translation="MTAPNEPGALSKGDGPNADGLVDRGGAHRAATGPGRIPDAGDPPP
FT                   WQRAATRQSQAGHRQPPPVSHPEGRPTNPPAAADARLNRFISGASAPVTGPAAAVRTPQ
FT                   PDPDASLGCGDGSPAEAYASELPDLSGPTPRAPQRNPAPARPAEGGAGSRGDSAAGSSG
FT                   GRSITAESRDARVQLSARRSRGPVRASMQIRRIDPWSTLKVSLLLSVALFFVWMITVAF
FT                   LYLVLGGMGVWAKLNSNVGDLLNNASGSSAELVSSGTIFGGAFLIGLVNIVLMTALATI
FT                   GAFVYNLITDLIGGIEVTLADRD"
     gtgactgcac cgaacgagcc gggggcgctc agcaagggcg acggcccgaa tgcggatggc        60
     ttggtcgacc gtgggggcgc acatcgggca gcgaccgggc caggccgcat accagatgct       120
     ggagacccgc cgccgtggca gcgtgctgcg actcggcaat cccaagcggg gcatcgtcag       180
     ccgccgccgg tatcacaccc tgaggggcgc ccgaccaacc cgcccgccgc cgccgatgct       240
     cggctgaatc gcttcatctc cggtgcgtct gccccggtga ccggcccagc cgccgcggtc       300
     aggaccccgc agccggatcc cgacgcttcg ctggggtgtg gcgacggttc ccccgccgag       360
     gcctatgcca gcgagctgcc cgacctatcc ggcccgactc cgcgggcccc gcaacgcaac       420
     cccgcgccgg cgcgtcccgc ggagggtggc gcgggatcga gaggggattc ggccgccggt       480
     tcgagcggcg gtcgttcgat taccgctgag agtagagacg cccgtgtcca gctgtcggcg       540
     cggcgaagcc gcgggccggt tcgagccagc atgcagatcc gacggattga tccatggagc       600
     acgttgaagg tgtcgctgtt gttgtcggtg gcgctgttct tcgtctggat gatcacggtc       660
     gcgttcctct acctggtgct cggcggtatg ggcgtatggg ccaagctcaa cagcaacgtc       720
     ggtgacctgt tgaacaacgc gagcggcagc agcgcggaac ttgtctccag cggcaccatc       780
     ttcggcggcg cattcctgat cggcttggtc aacatcgtcc tgatgaccgc gcttgccacc       840
     atcggtgcgt tcgtctacaa cctgatcacc gatctgatcg gcggcatcga agtgacgctg       900
     gcagaccggg actaa                                                        915
//

If you have problems or comments...

PBIL Back to PBIL home page