(data stored in ACNUC7421 zone)

EMBL: CP001658.PE704

CP001658.PE704       Location/Qualifiers
FT   CDS_pept        complement(779261..779689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00690"
FT                   /product="membrane protein mmpS5"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00690"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23725"
FT                   /protein_id="ACT23725.1"
FT                   /translation="MIGTLKRAWIPLLILVVVAIAGFTVQRIRTFFGSEGILVTPKVFA
FT                   DDPEPFDPKVVEYEVSGSGSYVNINYLDLDAKPQRIDGAALPWSLTLKTTAPSAAPNIL
FT                   AQGDGTSITCRITVDGEVKDERTATGVDALTYCFVKSA"
     atgattggaa ctctcaagcg tgcctggata ccgctgctca tcctggttgt ggtcgccatc        60
     gccggcttca cggtgcagcg gatccgcact ttctttggtt ccgaaggcat cttggtgacg       120
     ccgaaggtct tcgccgatga cccggagccg ttcgacccca aggtggtgga gtacgaagtt       180
     tccggctccg gtagttacgt caacatcaac tacctggacc tcgacgccaa gccacagcgg       240
     atcgacggcg cagccctgcc gtggtcgctc accttgaaga ccacggcgcc gtccgcggcc       300
     cccaacatcc tcgcgcaagg cgacggcact tccatcacct gccgaatcac cgtcgatggc       360
     gaagtgaagg acgagcggac cgcaaccggc gtggatgccc tgacctactg ctttgtgaaa       420
     tccgcatga                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page